BLASTX nr result
ID: Papaver30_contig00027441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00027441 (1782 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010031032.1| PREDICTED: mediator of RNA polymerase II tra... 63 1e-06 ref|XP_010057617.1| PREDICTED: mediator of RNA polymerase II tra... 63 1e-06 ref|XP_010057610.1| PREDICTED: mediator of RNA polymerase II tra... 63 1e-06 ref|XP_010057609.1| PREDICTED: mediator of RNA polymerase II tra... 63 1e-06 ref|XP_010057607.1| PREDICTED: mediator of RNA polymerase II tra... 63 1e-06 ref|XP_010057606.1| PREDICTED: mediator of RNA polymerase II tra... 63 1e-06 gb|KCW50308.1| hypothetical protein EUGRSUZ_J00090 [Eucalyptus g... 63 1e-06 ref|XP_010031031.1| PREDICTED: mediator of RNA polymerase II tra... 63 1e-06 ref|XP_010057608.1| PREDICTED: mediator of RNA polymerase II tra... 62 1e-06 ref|XP_010245153.1| PREDICTED: mediator of RNA polymerase II tra... 61 3e-06 ref|XP_010245151.1| PREDICTED: mediator of RNA polymerase II tra... 61 3e-06 ref|XP_010057528.1| PREDICTED: F-box/LRR-repeat protein At5g0291... 61 3e-06 ref|XP_010057527.1| PREDICTED: F-box/LRR-repeat protein At5g0291... 61 3e-06 ref|XP_010244438.1| PREDICTED: mediator of RNA polymerase II tra... 61 4e-06 ref|XP_011658765.1| PREDICTED: mediator of RNA polymerase II tra... 60 5e-06 ref|XP_011087375.1| PREDICTED: mediator of RNA polymerase II tra... 60 5e-06 ref|XP_011087374.1| PREDICTED: mediator of RNA polymerase II tra... 60 5e-06 ref|XP_009770214.1| PREDICTED: mediator of RNA polymerase II tra... 60 5e-06 ref|XP_009770212.1| PREDICTED: mediator of RNA polymerase II tra... 60 5e-06 ref|XP_009770211.1| PREDICTED: mediator of RNA polymerase II tra... 60 5e-06 >ref|XP_010031032.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X2 [Eucalyptus grandis] Length = 1135 Score = 62.8 bits (151), Expect = 1e-06 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SGPEGL EL K+AVRFEEKI+TAA + Y Sbjct: 46 METLKRHLPVSGPEGLQELKKIAVRFEEKIYTAATSQSDY 85 >ref|XP_010057617.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X6 [Eucalyptus grandis] Length = 652 Score = 62.8 bits (151), Expect = 1e-06 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVYHSMWC 1647 +ETLKRHLP+SGPEGL EL K+AVRFEEKI+TAA + Y C Sbjct: 46 METLKRHLPVSGPEGLQELKKIAVRFEEKIYTAAISQSDYLRKIC 90 >ref|XP_010057610.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X5 [Eucalyptus grandis] Length = 683 Score = 62.8 bits (151), Expect = 1e-06 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SGPEGL EL K+AVRFEEKI+TAA + Y Sbjct: 45 METLKRHLPVSGPEGLQELKKIAVRFEEKIYTAATSQSDY 84 >ref|XP_010057609.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] gi|702349745|ref|XP_010057611.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] gi|702349752|ref|XP_010057612.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] gi|702349759|ref|XP_010057613.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] gi|702349766|ref|XP_010057615.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] gi|702349773|ref|XP_010057616.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] Length = 683 Score = 62.8 bits (151), Expect = 1e-06 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVYHSMWC 1647 +ETLKRHLP+SGPEGL EL K+AVRFEEKI+TAA + Y C Sbjct: 45 METLKRHLPVSGPEGLQELKKIAVRFEEKIYTAAISQSDYLRKIC 89 >ref|XP_010057607.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X2 [Eucalyptus grandis] Length = 684 Score = 62.8 bits (151), Expect = 1e-06 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SGPEGL EL K+AVRFEEKI+TAA + Y Sbjct: 46 METLKRHLPVSGPEGLQELKKIAVRFEEKIYTAATSQSDY 85 >ref|XP_010057606.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X1 [Eucalyptus grandis] Length = 684 Score = 62.8 bits (151), Expect = 1e-06 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVYHSMWC 1647 +ETLKRHLP+SGPEGL EL K+AVRFEEKI+TAA + Y C Sbjct: 46 METLKRHLPVSGPEGLQELKKIAVRFEEKIYTAAISQSDYLRKIC 90 >gb|KCW50308.1| hypothetical protein EUGRSUZ_J00090 [Eucalyptus grandis] Length = 1296 Score = 62.8 bits (151), Expect = 1e-06 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SGPEGL EL K+AVRFEEKI+TAA + Y Sbjct: 46 METLKRHLPVSGPEGLQELKKIAVRFEEKIYTAATSQSDY 85 >ref|XP_010031031.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X1 [Eucalyptus grandis] gi|629083950|gb|KCW50307.1| hypothetical protein EUGRSUZ_J00090 [Eucalyptus grandis] Length = 1368 Score = 62.8 bits (151), Expect = 1e-06 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SGPEGL EL K+AVRFEEKI+TAA + Y Sbjct: 46 METLKRHLPVSGPEGLQELKKIAVRFEEKIYTAATSQSDY 85 >ref|XP_010057608.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X3 [Eucalyptus grandis] Length = 684 Score = 62.4 bits (150), Expect = 1e-06 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SGPEGL EL K+AVRFEEKI+TAA + Y Sbjct: 46 METLKRHLPVSGPEGLQELKKIAVRFEEKIYTAAISQSDY 85 >ref|XP_010245153.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X2 [Nelumbo nucifera] Length = 1386 Score = 61.2 bits (147), Expect = 3e-06 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 ++TLK+HLPISGPEGL EL K+AVRFEEKI+TAA++ Y Sbjct: 43 MDTLKKHLPISGPEGLQELKKIAVRFEEKIYTAASSQSDY 82 >ref|XP_010245151.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X1 [Nelumbo nucifera] gi|720090613|ref|XP_010245152.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X1 [Nelumbo nucifera] Length = 1422 Score = 61.2 bits (147), Expect = 3e-06 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 ++TLK+HLPISGPEGL EL K+AVRFEEKI+TAA++ Y Sbjct: 43 MDTLKKHLPISGPEGLQELKKIAVRFEEKIYTAASSQSDY 82 >ref|XP_010057528.1| PREDICTED: F-box/LRR-repeat protein At5g02910-like isoform X2 [Eucalyptus grandis] Length = 606 Score = 61.2 bits (147), Expect = 3e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SGPEGL EL+K+AVRFEEKI+ AA + Y Sbjct: 49 METLKRHLPVSGPEGLRELNKIAVRFEEKIYAAAVSQSDY 88 >ref|XP_010057527.1| PREDICTED: F-box/LRR-repeat protein At5g02910-like isoform X1 [Eucalyptus grandis] Length = 607 Score = 61.2 bits (147), Expect = 3e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SGPEGL EL+K+AVRFEEKI+ AA + Y Sbjct: 49 METLKRHLPVSGPEGLRELNKIAVRFEEKIYAAAVSQSDY 88 >ref|XP_010244438.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like [Nelumbo nucifera] Length = 1410 Score = 60.8 bits (146), Expect = 4e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 381 SDYLRKISLKFLSMETKFQKNAVANSLPLNTAGGSQNPQDP 259 +DYLRKISLK L+METK Q N V NSLP N+AGG+ NP DP Sbjct: 80 ADYLRKISLKMLTMETKSQPNIVPNSLPSNSAGGNPNPVDP 120 >ref|XP_011658765.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a [Cucumis sativus] Length = 1350 Score = 60.5 bits (145), Expect = 5e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SG EGL EL K+AVRFEEKIFTAA + Y Sbjct: 38 METLKRHLPVSGQEGLSELRKIAVRFEEKIFTAATSQSDY 77 >ref|XP_011087375.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X2 [Sesamum indicum] Length = 1372 Score = 60.5 bits (145), Expect = 5e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP SG EGL EL K+AVRFEEKI+TAA + Q Y Sbjct: 52 METLKRHLPFSGQEGLQELKKIAVRFEEKIYTAATSQQDY 91 >ref|XP_011087374.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X1 [Sesamum indicum] Length = 1375 Score = 60.5 bits (145), Expect = 5e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP SG EGL EL K+AVRFEEKI+TAA + Q Y Sbjct: 52 METLKRHLPFSGQEGLQELKKIAVRFEEKIYTAATSQQDY 91 >ref|XP_009770214.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X4 [Nicotiana sylvestris] Length = 1197 Score = 60.5 bits (145), Expect = 5e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SG EG+ EL K+AVRFEEKI+TAA + Q Y Sbjct: 54 METLKRHLPVSGQEGVQELKKIAVRFEEKIYTAATSQQDY 93 >ref|XP_009770212.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X3 [Nicotiana sylvestris] Length = 1324 Score = 60.5 bits (145), Expect = 5e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SG EG+ EL K+AVRFEEKI+TAA + Q Y Sbjct: 54 METLKRHLPVSGQEGVQELKKIAVRFEEKIYTAATSQQDY 93 >ref|XP_009770211.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X2 [Nicotiana sylvestris] Length = 1353 Score = 60.5 bits (145), Expect = 5e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 1781 VETLKRHLPISGPEGLVELDKLAVRFEEKIFTAAAASQVY 1662 +ETLKRHLP+SG EG+ EL K+AVRFEEKI+TAA + Q Y Sbjct: 54 METLKRHLPVSGQEGVQELKKIAVRFEEKIYTAATSQQDY 93