BLASTX nr result
ID: Papaver30_contig00026730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00026730 (599 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFK38267.1| hypothetical protein AALP_AA3G091600 [Arabis alpina] 83 2e-14 ref|XP_006429637.1| hypothetical protein CICLE_v10011315mg [Citr... 82 9e-14 ref|XP_006481239.1| PREDICTED: BTB/POZ domain-containing protein... 82 9e-14 gb|KDO64171.1| hypothetical protein CISIN_1g035818mg, partial [C... 82 9e-14 ref|XP_010922793.1| PREDICTED: BTB/POZ domain-containing protein... 79 2e-13 ref|XP_008803011.1| PREDICTED: BTB/POZ domain-containing protein... 79 2e-13 ref|XP_010931396.1| PREDICTED: BTB/POZ domain-containing protein... 79 3e-13 ref|XP_010931398.1| PREDICTED: BTB/POZ domain-containing protein... 79 3e-13 ref|XP_010244571.1| PREDICTED: BTB/POZ domain-containing protein... 78 3e-13 ref|XP_010244572.1| PREDICTED: BTB/POZ domain-containing protein... 78 3e-13 ref|XP_009605134.1| PREDICTED: BTB/POZ domain-containing protein... 78 4e-13 ref|XP_002882578.1| hypothetical protein ARALYDRAFT_478168 [Arab... 79 4e-13 ref|XP_009605138.1| PREDICTED: BTB/POZ domain-containing protein... 78 4e-13 ref|NP_187478.1| phototropic-responsive NPH3 family protein [Ara... 79 4e-13 ref|XP_010486408.1| PREDICTED: putative BTB/POZ domain-containin... 79 4e-13 gb|KHN29482.1| BTB/POZ domain-containing protein [Glycine soja] 77 6e-13 ref|XP_006587903.1| PREDICTED: BTB/POZ domain-containing protein... 77 6e-13 ref|XP_006587904.1| PREDICTED: BTB/POZ domain-containing protein... 77 6e-13 ref|XP_006587905.1| PREDICTED: BTB/POZ domain-containing protein... 77 6e-13 ref|XP_006587906.1| PREDICTED: BTB/POZ domain-containing protein... 77 6e-13 >gb|KFK38267.1| hypothetical protein AALP_AA3G091600 [Arabis alpina] Length = 589 Score = 83.2 bits (204), Expect(2) = 2e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP LTE ESKKLCKYIDC+KLSQEASNHVA NDRLPVQ+ VR+L Sbjct: 420 KAHPLLTEEESKKLCKYIDCKKLSQEASNHVAQNDRLPVQMVVRVL 465 Score = 22.3 bits (46), Expect(2) = 2e-14 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LY EQLRLKKA Sbjct: 465 LYSEQLRLKKA 475 >ref|XP_006429637.1| hypothetical protein CICLE_v10011315mg [Citrus clementina] gi|568855286|ref|XP_006481238.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Citrus sinensis] gi|557531694|gb|ESR42877.1| hypothetical protein CICLE_v10011315mg [Citrus clementina] Length = 611 Score = 81.6 bits (200), Expect(2) = 9e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP LTE+E KKLCK+IDCQKLSQEASNH A NDRLPVQ+AVR+L Sbjct: 438 KAHPMLTEHECKKLCKFIDCQKLSQEASNHAAQNDRLPVQMAVRVL 483 Score = 21.9 bits (45), Expect(2) = 9e-14 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRL+ A Sbjct: 483 LYFEQLRLQNA 493 >ref|XP_006481239.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Citrus sinensis] Length = 591 Score = 81.6 bits (200), Expect(2) = 9e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP LTE+E KKLCK+IDCQKLSQEASNH A NDRLPVQ+AVR+L Sbjct: 418 KAHPMLTEHECKKLCKFIDCQKLSQEASNHAAQNDRLPVQMAVRVL 463 Score = 21.9 bits (45), Expect(2) = 9e-14 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRL+ A Sbjct: 463 LYFEQLRLQNA 473 >gb|KDO64171.1| hypothetical protein CISIN_1g035818mg, partial [Citrus sinensis] Length = 568 Score = 81.6 bits (200), Expect(2) = 9e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP LTE+E KKLCK+IDCQKLSQEASNH A NDRLPVQ+AVR+L Sbjct: 395 KAHPMLTEHECKKLCKFIDCQKLSQEASNHAAQNDRLPVQMAVRVL 440 Score = 21.9 bits (45), Expect(2) = 9e-14 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRL+ A Sbjct: 440 LYFEQLRLQNA 450 >ref|XP_010922793.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like [Elaeis guineensis] Length = 609 Score = 79.0 bits (193), Expect(2) = 2e-13 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP+LTE+E KKLCK IDCQKLSQEASNH A NDRLPVQ+ +R+L Sbjct: 433 KAHPSLTESECKKLCKLIDCQKLSQEASNHAAQNDRLPVQMVIRVL 478 Score = 23.5 bits (49), Expect(2) = 2e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 478 LYFEQLRLKSA 488 >ref|XP_008803011.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like [Phoenix dactylifera] Length = 609 Score = 79.0 bits (193), Expect(2) = 2e-13 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP+LTE+E KKLCK IDCQKLSQEASNH A NDRLPVQ+ +R+L Sbjct: 433 KAHPSLTESECKKLCKLIDCQKLSQEASNHAAQNDRLPVQMVIRVL 478 Score = 23.5 bits (49), Expect(2) = 2e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 478 LYFEQLRLKSA 488 >ref|XP_010931396.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Elaeis guineensis] Length = 611 Score = 78.6 bits (192), Expect(2) = 3e-13 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP++TE+E KKLCK IDCQKLSQEASNH A NDRLPVQ+ VR+L Sbjct: 433 KAHPSMTESECKKLCKLIDCQKLSQEASNHAAQNDRLPVQMVVRVL 478 Score = 23.5 bits (49), Expect(2) = 3e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 478 LYFEQLRLKSA 488 >ref|XP_010931398.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Elaeis guineensis] Length = 548 Score = 78.6 bits (192), Expect(2) = 3e-13 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP++TE+E KKLCK IDCQKLSQEASNH A NDRLPVQ+ VR+L Sbjct: 370 KAHPSMTESECKKLCKLIDCQKLSQEASNHAAQNDRLPVQMVVRVL 415 Score = 23.5 bits (49), Expect(2) = 3e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 415 LYFEQLRLKSA 425 >ref|XP_010244571.1| PREDICTED: BTB/POZ domain-containing protein At3g08570 isoform X1 [Nelumbo nucifera] Length = 609 Score = 78.2 bits (191), Expect(2) = 3e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP LTENE K LCK+IDCQKLSQEA NH A NDRLPVQ+ VR+L Sbjct: 435 KAHPMLTENECKNLCKFIDCQKLSQEACNHAAQNDRLPVQMVVRVL 480 Score = 23.5 bits (49), Expect(2) = 3e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 480 LYFEQLRLKNA 490 >ref|XP_010244572.1| PREDICTED: BTB/POZ domain-containing protein At3g08570 isoform X2 [Nelumbo nucifera] Length = 600 Score = 78.2 bits (191), Expect(2) = 3e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP LTENE K LCK+IDCQKLSQEA NH A NDRLPVQ+ VR+L Sbjct: 426 KAHPMLTENECKNLCKFIDCQKLSQEACNHAAQNDRLPVQMVVRVL 471 Score = 23.5 bits (49), Expect(2) = 3e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 471 LYFEQLRLKNA 481 >ref|XP_009605134.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Nicotiana tomentosiformis] Length = 624 Score = 77.8 bits (190), Expect(2) = 4e-13 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP L+E+E+KKLCK+IDCQKLSQEA NH A NDRLPVQ+ VR+L Sbjct: 450 KAHPTLSEHEAKKLCKFIDCQKLSQEACNHAARNDRLPVQMTVRVL 495 Score = 23.5 bits (49), Expect(2) = 4e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 495 LYFEQLRLKNA 505 >ref|XP_002882578.1| hypothetical protein ARALYDRAFT_478168 [Arabidopsis lyrata subsp. lyrata] gi|297328418|gb|EFH58837.1| hypothetical protein ARALYDRAFT_478168 [Arabidopsis lyrata subsp. lyrata] Length = 606 Score = 79.0 bits (193), Expect(2) = 4e-13 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRILST 449 +AHP LTE E KKLCK+IDC+KLSQEASNHVA NDRLPV + VR+L T Sbjct: 414 KAHPLLTEEECKKLCKFIDCKKLSQEASNHVAQNDRLPVHMVVRVLYT 461 Score = 22.3 bits (46), Expect(2) = 4e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LY EQLRLKKA Sbjct: 459 LYTEQLRLKKA 469 >ref|XP_009605138.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Nicotiana tomentosiformis] gi|697103211|ref|XP_009605144.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Nicotiana tomentosiformis] gi|697103213|ref|XP_009605152.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Nicotiana tomentosiformis] Length = 592 Score = 77.8 bits (190), Expect(2) = 4e-13 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP L+E+E+KKLCK+IDCQKLSQEA NH A NDRLPVQ+ VR+L Sbjct: 418 KAHPTLSEHEAKKLCKFIDCQKLSQEACNHAARNDRLPVQMTVRVL 463 Score = 23.5 bits (49), Expect(2) = 4e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 463 LYFEQLRLKNA 473 >ref|NP_187478.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana] gi|75262254|sp|Q9C9Z0.1|Y3866_ARATH RecName: Full=Putative BTB/POZ domain-containing protein At3g08660 gi|12322729|gb|AAG51353.1|AC012562_14 putative non-phototropic hypocotyl; 42053-44089 [Arabidopsis thaliana] gi|332641139|gb|AEE74660.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana] Length = 582 Score = 79.0 bits (193), Expect(2) = 4e-13 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRILST 449 +AHP LTE E KKLC +IDC+KLSQEASNHVA NDRLPVQ+ VR+L T Sbjct: 415 KAHPLLTEEERKKLCNFIDCKKLSQEASNHVAQNDRLPVQMVVRVLYT 462 Score = 22.3 bits (46), Expect(2) = 4e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LY EQLRLKKA Sbjct: 460 LYTEQLRLKKA 470 >ref|XP_010486408.1| PREDICTED: putative BTB/POZ domain-containing protein At3g08660 [Camelina sativa] Length = 581 Score = 79.0 bits (193), Expect(2) = 4e-13 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHP LTE ESKKLCK+IDC KLS+EASNHVA NDRLPVQ+ VR+L Sbjct: 412 KAHPLLTEVESKKLCKFIDCNKLSEEASNHVAQNDRLPVQMVVRVL 457 Score = 22.3 bits (46), Expect(2) = 4e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LY EQLRLKKA Sbjct: 457 LYSEQLRLKKA 467 >gb|KHN29482.1| BTB/POZ domain-containing protein [Glycine soja] Length = 608 Score = 77.4 bits (189), Expect(2) = 6e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHPALTE E KKLCK IDCQKLSQEASNH A NDRLP+Q+ V++L Sbjct: 434 KAHPALTEQECKKLCKLIDCQKLSQEASNHAAQNDRLPLQMVVQVL 479 Score = 23.5 bits (49), Expect(2) = 6e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 479 LYFEQLRLKNA 489 >ref|XP_006587903.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Glycine max] gi|947091996|gb|KRH40661.1| hypothetical protein GLYMA_09G272500 [Glycine max] Length = 608 Score = 77.4 bits (189), Expect(2) = 6e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHPALTE E KKLCK IDCQKLSQEASNH A NDRLP+Q+ V++L Sbjct: 434 KAHPALTEQECKKLCKLIDCQKLSQEASNHAAQNDRLPLQMVVQVL 479 Score = 23.5 bits (49), Expect(2) = 6e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 479 LYFEQLRLKNA 489 >ref|XP_006587904.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Glycine max] gi|947091995|gb|KRH40660.1| hypothetical protein GLYMA_09G272500 [Glycine max] Length = 598 Score = 77.4 bits (189), Expect(2) = 6e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHPALTE E KKLCK IDCQKLSQEASNH A NDRLP+Q+ V++L Sbjct: 434 KAHPALTEQECKKLCKLIDCQKLSQEASNHAAQNDRLPLQMVVQVL 479 Score = 23.5 bits (49), Expect(2) = 6e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 479 LYFEQLRLKNA 489 >ref|XP_006587905.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X3 [Glycine max] Length = 597 Score = 77.4 bits (189), Expect(2) = 6e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHPALTE E KKLCK IDCQKLSQEASNH A NDRLP+Q+ V++L Sbjct: 423 KAHPALTEQECKKLCKLIDCQKLSQEASNHAAQNDRLPLQMVVQVL 468 Score = 23.5 bits (49), Expect(2) = 6e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 468 LYFEQLRLKNA 478 >ref|XP_006587906.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X4 [Glycine max] gi|571479597|ref|XP_006587907.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X5 [Glycine max] Length = 548 Score = 77.4 bits (189), Expect(2) = 6e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 592 QAHPALTENESKKLCKYIDCQKLSQEASNHVAHNDRLPVQVAVRIL 455 +AHPALTE E KKLCK IDCQKLSQEASNH A NDRLP+Q+ V++L Sbjct: 374 KAHPALTEQECKKLCKLIDCQKLSQEASNHAAQNDRLPLQMVVQVL 419 Score = 23.5 bits (49), Expect(2) = 6e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 455 LYFEQLRLKKA 423 LYFEQLRLK A Sbjct: 419 LYFEQLRLKNA 429