BLASTX nr result
ID: Papaver30_contig00024435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00024435 (990 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006481146.1| PREDICTED: LOW QUALITY PROTEIN: regulatory-a... 58 4e-12 ref|XP_011466431.1| PREDICTED: regulatory-associated protein of ... 58 4e-12 ref|XP_004302528.1| PREDICTED: regulatory-associated protein of ... 58 4e-12 ref|XP_012089724.1| PREDICTED: regulatory-associated protein of ... 58 4e-12 ref|XP_003632587.1| PREDICTED: regulatory-associated protein of ... 58 4e-12 ref|XP_004149929.1| PREDICTED: regulatory-associated protein of ... 58 4e-12 gb|KDP22798.1| hypothetical protein JCGZ_00385 [Jatropha curcas] 58 4e-12 ref|XP_012089725.1| PREDICTED: regulatory-associated protein of ... 58 4e-12 ref|XP_010553139.1| PREDICTED: regulatory-associated protein of ... 58 4e-12 ref|XP_006429536.1| hypothetical protein CICLE_v10010918mg [Citr... 58 4e-12 ref|XP_007208391.1| hypothetical protein PRUPE_ppa000282mg [Prun... 58 4e-12 ref|XP_006429535.1| hypothetical protein CICLE_v10010918mg [Citr... 58 4e-12 ref|XP_002533827.1| Regulatory-associated protein of mTOR, putat... 58 4e-12 ref|XP_002531312.1| conserved hypothetical protein [Ricinus comm... 58 4e-12 ref|XP_010553141.1| PREDICTED: regulatory-associated protein of ... 58 4e-12 gb|KDO49632.1| hypothetical protein CISIN_1g0006812mg, partial [... 58 4e-12 gb|KDO49630.1| hypothetical protein CISIN_1g0006812mg, partial [... 58 4e-12 gb|KDO49633.1| hypothetical protein CISIN_1g0006812mg, partial [... 58 4e-12 ref|XP_008245459.1| PREDICTED: regulatory-associated protein of ... 58 4e-12 gb|KOM37417.1| hypothetical protein LR48_Vigan03g079900 [Vigna a... 58 5e-12 >ref|XP_006481146.1| PREDICTED: LOW QUALITY PROTEIN: regulatory-associated protein of TOR 1-like [Citrus sinensis] Length = 1374 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 354 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 387 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 391 CSPISHPMLPPTHQHHM 407 >ref|XP_011466431.1| PREDICTED: regulatory-associated protein of TOR 1 isoform X1 [Fragaria vesca subsp. vesca] Length = 1372 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 355 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 388 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHP LPSTHQHHM Sbjct: 392 CSPISHPQLPSTHQHHM 408 >ref|XP_004302528.1| PREDICTED: regulatory-associated protein of TOR 1 isoform X2 [Fragaria vesca subsp. vesca] Length = 1365 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 348 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 381 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHP LPSTHQHHM Sbjct: 385 CSPISHPQLPSTHQHHM 401 >ref|XP_012089724.1| PREDICTED: regulatory-associated protein of TOR 1 isoform X1 [Jatropha curcas] Length = 1363 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 353 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 386 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 390 CSPISHPMLPPTHQHHM 406 >ref|XP_003632587.1| PREDICTED: regulatory-associated protein of TOR 1 [Vitis vinifera] gi|297735579|emb|CBI18073.3| unnamed protein product [Vitis vinifera] Length = 1363 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 350 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 383 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 387 CSPISHPMLPPTHQHHM 403 >ref|XP_004149929.1| PREDICTED: regulatory-associated protein of TOR 1 [Cucumis sativus] gi|700199271|gb|KGN54429.1| hypothetical protein Csa_4G325540 [Cucumis sativus] Length = 1362 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 349 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 382 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 386 CSPISHPMLPPTHQHHM 402 >gb|KDP22798.1| hypothetical protein JCGZ_00385 [Jatropha curcas] Length = 1357 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 347 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 380 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 384 CSPISHPMLPPTHQHHM 400 >ref|XP_012089725.1| PREDICTED: regulatory-associated protein of TOR 1 isoform X2 [Jatropha curcas] Length = 1355 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 353 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 386 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 390 CSPISHPMLPPTHQHHM 406 >ref|XP_010553139.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X1 [Tarenaya hassleriana] gi|729395673|ref|XP_010553140.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X1 [Tarenaya hassleriana] Length = 1355 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 366 WNVLPRDLFQRLFRQDLLVASLFRNFLLAERIMR 399 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 403 CSPISHPMLPPTHQHHM 419 >ref|XP_006429536.1| hypothetical protein CICLE_v10010918mg [Citrus clementina] gi|557531593|gb|ESR42776.1| hypothetical protein CICLE_v10010918mg [Citrus clementina] Length = 1348 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 354 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 387 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 391 CSPISHPMLPPTHQHHM 407 >ref|XP_007208391.1| hypothetical protein PRUPE_ppa000282mg [Prunus persica] gi|462404033|gb|EMJ09590.1| hypothetical protein PRUPE_ppa000282mg [Prunus persica] Length = 1346 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 352 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 385 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 389 CSPISHPMLPPTHQHHM 405 >ref|XP_006429535.1| hypothetical protein CICLE_v10010918mg [Citrus clementina] gi|557531592|gb|ESR42775.1| hypothetical protein CICLE_v10010918mg [Citrus clementina] Length = 1256 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 354 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 387 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 391 CSPISHPMLPPTHQHHM 407 >ref|XP_002533827.1| Regulatory-associated protein of mTOR, putative [Ricinus communis] gi|223526244|gb|EEF28562.1| Regulatory-associated protein of mTOR, putative [Ricinus communis] Length = 1221 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 36/81 (44%), Positives = 44/81 (54%) Frame = +1 Query: 694 YRCMYTRSRILRVWLRHQNARGRPCLCFA*REVHHGIISKSFCWFRDWDSSA*DLFQRLF 873 ++ Y R L+V L N PC +++ + W + LFQRLF Sbjct: 185 HKLAYYEERQLKVHLASLN----PCF----------LLTHEYVQTNMWQNKVFHLFQRLF 230 Query: 874 RQDLLVASLFRNFLLAERIMR 936 RQDLLVASLFRNFLLAERIMR Sbjct: 231 RQDLLVASLFRNFLLAERIMR 251 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 255 CSPISHPMLPPTHQHHM 271 >ref|XP_002531312.1| conserved hypothetical protein [Ricinus communis] gi|223529080|gb|EEF31062.1| conserved hypothetical protein [Ricinus communis] Length = 1108 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 432 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 465 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 469 CSPISHPMLPPTHQHHM 485 >ref|XP_010553141.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X2 [Tarenaya hassleriana] Length = 1096 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 107 WNVLPRDLFQRLFRQDLLVASLFRNFLLAERIMR 140 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 144 CSPISHPMLPPTHQHHM 160 >gb|KDO49632.1| hypothetical protein CISIN_1g0006812mg, partial [Citrus sinensis] Length = 1046 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 46 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 79 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 83 CSPISHPMLPPTHQHHM 99 >gb|KDO49630.1| hypothetical protein CISIN_1g0006812mg, partial [Citrus sinensis] gi|641830546|gb|KDO49631.1| hypothetical protein CISIN_1g0006812mg, partial [Citrus sinensis] Length = 1040 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 46 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 79 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 83 CSPISHPMLPPTHQHHM 99 >gb|KDO49633.1| hypothetical protein CISIN_1g0006812mg, partial [Citrus sinensis] Length = 954 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 46 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 79 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 83 CSPISHPMLPPTHQHHM 99 >ref|XP_008245459.1| PREDICTED: regulatory-associated protein of TOR 1 [Prunus mume] Length = 689 Score = 57.8 bits (138), Expect(2) = 4e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 327 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 360 Score = 42.0 bits (97), Expect(2) = 4e-12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSPISHPMLP THQHHM Sbjct: 364 CSPISHPMLPPTHQHHM 380 >gb|KOM37417.1| hypothetical protein LR48_Vigan03g079900 [Vigna angularis] Length = 1580 Score = 57.8 bits (138), Expect(2) = 5e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 835 WDSSA*DLFQRLFRQDLLVASLFRNFLLAERIMR 936 W+ DLFQRLFRQDLLVASLFRNFLLAERIMR Sbjct: 461 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 494 Score = 41.6 bits (96), Expect(2) = 5e-12 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +2 Query: 938 CSPISHPMLPSTHQHHM 988 CSP+SHPMLP THQHHM Sbjct: 498 CSPVSHPMLPPTHQHHM 514