BLASTX nr result
ID: Papaver30_contig00024363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00024363 (1023 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010062705.1| PREDICTED: BTB/POZ domain-containing protein... 59 5e-06 gb|KCW69832.1| hypothetical protein EUGRSUZ_F03182 [Eucalyptus g... 59 5e-06 gb|KCW69831.1| hypothetical protein EUGRSUZ_F03182 [Eucalyptus g... 59 5e-06 ref|XP_012087427.1| PREDICTED: BTB/POZ domain-containing protein... 59 6e-06 gb|KDP25127.1| hypothetical protein JCGZ_22662 [Jatropha curcas] 59 6e-06 >ref|XP_010062705.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 [Eucalyptus grandis] Length = 1011 Score = 59.3 bits (142), Expect = 5e-06 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = -2 Query: 359 DVIVETKVKTEMNFSYSASPPSMPHMHVHRIALWLSCDYLMVLFQSGM*E 210 D+I+E+K +E++++ S S+PHMHVHRI LW SCDYL L QSGM E Sbjct: 818 DIILESKA-SELSWTCSICSLSVPHMHVHRIILWASCDYLQALLQSGMQE 866 >gb|KCW69832.1| hypothetical protein EUGRSUZ_F03182 [Eucalyptus grandis] Length = 580 Score = 59.3 bits (142), Expect = 5e-06 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = -2 Query: 359 DVIVETKVKTEMNFSYSASPPSMPHMHVHRIALWLSCDYLMVLFQSGM*E 210 D+I+E+K +E++++ S S+PHMHVHRI LW SCDYL L QSGM E Sbjct: 387 DIILESKA-SELSWTCSICSLSVPHMHVHRIILWASCDYLQALLQSGMQE 435 >gb|KCW69831.1| hypothetical protein EUGRSUZ_F03182 [Eucalyptus grandis] Length = 749 Score = 59.3 bits (142), Expect = 5e-06 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = -2 Query: 359 DVIVETKVKTEMNFSYSASPPSMPHMHVHRIALWLSCDYLMVLFQSGM*E 210 D+I+E+K +E++++ S S+PHMHVHRI LW SCDYL L QSGM E Sbjct: 556 DIILESKA-SELSWTCSICSLSVPHMHVHRIILWASCDYLQALLQSGMQE 604 >ref|XP_012087427.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 [Jatropha curcas] Length = 1009 Score = 58.9 bits (141), Expect = 6e-06 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -2 Query: 362 SDVIVETKVKTEMNFSYSASPPSMPHMHVHRIALWLSCDYLMVLFQSGM*E 210 SD+++E K + ++ S S+PHMH H++ LW SCDYL LFQSGM E Sbjct: 816 SDIVLEAKATKSICWTCSLCSQSVPHMHCHKVVLWSSCDYLRALFQSGMLE 866 >gb|KDP25127.1| hypothetical protein JCGZ_22662 [Jatropha curcas] Length = 679 Score = 58.9 bits (141), Expect = 6e-06 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -2 Query: 362 SDVIVETKVKTEMNFSYSASPPSMPHMHVHRIALWLSCDYLMVLFQSGM*E 210 SD+++E K + ++ S S+PHMH H++ LW SCDYL LFQSGM E Sbjct: 486 SDIVLEAKATKSICWTCSLCSQSVPHMHCHKVVLWSSCDYLRALFQSGMLE 536