BLASTX nr result
ID: Papaver30_contig00024244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00024244 (585 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010942073.1| PREDICTED: grpE protein homolog, mitochondri... 60 6e-07 ref|XP_008810324.1| PREDICTED: grpE protein homolog, mitochondri... 60 1e-06 ref|XP_002319738.1| co-chaperone grpE family protein [Populus tr... 59 2e-06 ref|XP_011047049.1| PREDICTED: grpE protein homolog, mitochondri... 58 3e-06 ref|XP_011047048.1| PREDICTED: grpE protein homolog, mitochondri... 58 3e-06 ref|XP_012070349.1| PREDICTED: grpE protein homolog, mitochondri... 58 3e-06 ref|XP_011629291.1| PREDICTED: grpE protein homolog, mitochondri... 57 5e-06 ref|XP_011629290.1| PREDICTED: grpE protein homolog, mitochondri... 57 5e-06 gb|ERM97282.1| hypothetical protein AMTR_s00119p00133730 [Ambore... 57 5e-06 ref|XP_008240630.1| PREDICTED: grpE protein homolog, mitochondri... 57 7e-06 ref|XP_008794362.1| PREDICTED: uncharacterized protein LOC103710... 57 9e-06 ref|XP_008794361.1| PREDICTED: grpE protein homolog, mitochondri... 57 9e-06 ref|XP_010036282.1| PREDICTED: grpE protein homolog, mitochondri... 57 9e-06 ref|XP_010036281.1| PREDICTED: grpE protein homolog, mitochondri... 57 9e-06 >ref|XP_010942073.1| PREDICTED: grpE protein homolog, mitochondrial [Elaeis guineensis] Length = 328 Score = 60.5 bits (145), Expect = 6e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -3 Query: 124 KSTSVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEKVS 2 K S +M SLQSYKEALANND+S ++EIEAFLQSIE EK S Sbjct: 104 KVASAVMVSLQSYKEALANNDQSKIAEIEAFLQSIEAEKNS 144 >ref|XP_008810324.1| PREDICTED: grpE protein homolog, mitochondrial-like, partial [Phoenix dactylifera] Length = 270 Score = 59.7 bits (143), Expect = 1e-06 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -3 Query: 124 KSTSVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEKVS 2 K S +M SLQSYKEALANND+S ++EIEAFLQSIE EK S Sbjct: 46 KVVSAVMVSLQSYKEALANNDQSKIAEIEAFLQSIEEEKNS 86 >ref|XP_002319738.1| co-chaperone grpE family protein [Populus trichocarpa] gi|222858114|gb|EEE95661.1| co-chaperone grpE family protein [Populus trichocarpa] Length = 342 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/39 (69%), Positives = 37/39 (94%) Frame = -3 Query: 121 STSVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEKV 5 ++SV+MASL+SYKEALA+NDES ++EIEAFL+S+E EK+ Sbjct: 118 TSSVVMASLRSYKEALASNDESIIAEIEAFLKSVEDEKI 156 >ref|XP_011047049.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Populus euphratica] Length = 337 Score = 58.2 bits (139), Expect = 3e-06 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 115 SVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEKV 5 SV+MASL+SYKEALA+NDES ++EIEAFL+SIE EK+ Sbjct: 115 SVVMASLRSYKEALASNDESIIAEIEAFLKSIEDEKI 151 >ref|XP_011047048.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Populus euphratica] Length = 338 Score = 58.2 bits (139), Expect = 3e-06 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 115 SVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEKV 5 SV+MASL+SYKEALA+NDES ++EIEAFL+SIE EK+ Sbjct: 116 SVVMASLRSYKEALASNDESIIAEIEAFLKSIEDEKI 152 >ref|XP_012070349.1| PREDICTED: grpE protein homolog, mitochondrial [Jatropha curcas] gi|643732528|gb|KDP39624.1| hypothetical protein JCGZ_02644 [Jatropha curcas] Length = 350 Score = 58.2 bits (139), Expect = 3e-06 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = -3 Query: 124 KSTSVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEKVS 2 ++ SVI+ASLQSYKEALA+NDES + EIEAFL+S+E EK++ Sbjct: 120 EAPSVILASLQSYKEALASNDESKIVEIEAFLKSVEDEKIN 160 >ref|XP_011629291.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Amborella trichopoda] Length = 352 Score = 57.4 bits (137), Expect = 5e-06 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 115 SVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEKVS 2 S + ASL+SY+EALANNDEST+ EIE FLQSIEVEK S Sbjct: 125 SAVKASLESYREALANNDESTLVEIEKFLQSIEVEKNS 162 >ref|XP_011629290.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Amborella trichopoda] Length = 353 Score = 57.4 bits (137), Expect = 5e-06 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 115 SVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEKVS 2 S + ASL+SY+EALANNDEST+ EIE FLQSIEVEK S Sbjct: 126 SAVKASLESYREALANNDESTLVEIEKFLQSIEVEKNS 163 >gb|ERM97282.1| hypothetical protein AMTR_s00119p00133730 [Amborella trichopoda] Length = 255 Score = 57.4 bits (137), Expect = 5e-06 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 115 SVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEKVS 2 S + ASL+SY+EALANNDEST+ EIE FLQSIEVEK S Sbjct: 28 SAVKASLESYREALANNDESTLVEIEKFLQSIEVEKNS 65 >ref|XP_008240630.1| PREDICTED: grpE protein homolog, mitochondrial [Prunus mume] gi|645270823|ref|XP_008240631.1| PREDICTED: grpE protein homolog, mitochondrial [Prunus mume] Length = 343 Score = 57.0 bits (136), Expect = 7e-06 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -3 Query: 124 KSTSVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEKVS 2 K S I+ASLQ YKEALA+NDES V+EIE+FL+SIE EK+S Sbjct: 119 KPVSAIIASLQLYKEALASNDESKVAEIESFLKSIEDEKIS 159 >ref|XP_008794362.1| PREDICTED: uncharacterized protein LOC103710438 isoform X2 [Phoenix dactylifera] Length = 234 Score = 56.6 bits (135), Expect = 9e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 124 KSTSVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEK 8 K S +M SLQSYKEALANND S V+E+EAFLQ IE EK Sbjct: 58 KVASAVMVSLQSYKEALANNDPSKVAEVEAFLQLIEAEK 96 >ref|XP_008794361.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X1 [Phoenix dactylifera] Length = 258 Score = 56.6 bits (135), Expect = 9e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 124 KSTSVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEK 8 K S +M SLQSYKEALANND S V+E+EAFLQ IE EK Sbjct: 58 KVASAVMVSLQSYKEALANNDPSKVAEVEAFLQLIEAEK 96 >ref|XP_010036282.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Eucalyptus grandis] gi|629081367|gb|KCW47812.1| hypothetical protein EUGRSUZ_K01549 [Eucalyptus grandis] Length = 291 Score = 56.6 bits (135), Expect = 9e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 124 KSTSVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEK 8 K+ S ++ SLQSYKEALA+NDES V+EIEAFL+SIE EK Sbjct: 108 KAASAVLISLQSYKEALASNDESKVAEIEAFLKSIEDEK 146 >ref|XP_010036281.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Eucalyptus grandis] gi|629081366|gb|KCW47811.1| hypothetical protein EUGRSUZ_K01549 [Eucalyptus grandis] Length = 333 Score = 56.6 bits (135), Expect = 9e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 124 KSTSVIMASLQSYKEALANNDESTVSEIEAFLQSIEVEK 8 K+ S ++ SLQSYKEALA+NDES V+EIEAFL+SIE EK Sbjct: 108 KAASAVLISLQSYKEALASNDESKVAEIEAFLKSIEDEK 146