BLASTX nr result
ID: Papaver30_contig00023686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00023686 (518 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010090352.1| GDSL esterase/lipase [Morus notabilis] gi|58... 82 1e-13 ref|XP_010255797.1| PREDICTED: mitochondrial ubiquitin ligase ac... 82 2e-13 gb|KNA20496.1| hypothetical protein SOVF_051850 [Spinacia oleracea] 82 2e-13 ref|XP_004290684.1| PREDICTED: mitochondrial ubiquitin ligase ac... 81 3e-13 ref|XP_010684326.1| PREDICTED: mitochondrial ubiquitin ligase ac... 80 5e-13 ref|XP_010684325.1| PREDICTED: mitochondrial ubiquitin ligase ac... 80 5e-13 ref|XP_006850825.2| PREDICTED: mitochondrial ubiquitin ligase ac... 79 1e-12 ref|XP_011625708.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 1e-12 gb|KRH71473.1| hypothetical protein GLYMA_02G149800 [Glycine max] 79 2e-12 ref|XP_010473635.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 2e-12 ref|XP_003518933.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 2e-12 ref|XP_014514930.1| PREDICTED: mitochondrial ubiquitin ligase ac... 78 2e-12 ref|XP_010070254.1| PREDICTED: E3 ubiquitin-protein ligase cblA-... 78 2e-12 ref|XP_002274008.1| PREDICTED: mitochondrial ubiquitin ligase ac... 78 2e-12 emb|CAN61806.1| hypothetical protein VITISV_014293 [Vitis vinifera] 78 2e-12 ref|XP_009356733.1| PREDICTED: mitochondrial ubiquitin ligase ac... 78 3e-12 gb|KHN03773.1| Mitochondrial ubiquitin ligase activator of NFKB ... 77 4e-12 ref|XP_008386573.1| PREDICTED: mitochondrial ubiquitin ligase ac... 77 4e-12 ref|XP_003536411.1| PREDICTED: mitochondrial ubiquitin ligase ac... 77 4e-12 ref|XP_011079799.1| PREDICTED: mitochondrial ubiquitin ligase ac... 77 5e-12 >ref|XP_010090352.1| GDSL esterase/lipase [Morus notabilis] gi|587849082|gb|EXB39322.1| GDSL esterase/lipase [Morus notabilis] Length = 751 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/46 (80%), Positives = 39/46 (84%), Gaps = 2/46 (4%) Frame = -2 Query: 514 SNGKTET--EKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 SN TE+ + SKKD LMPDLCVICLEQEYN VFVPCGHMCCCTTC Sbjct: 683 SNDITESGLDSSKKDRLMPDLCVICLEQEYNAVFVPCGHMCCCTTC 728 >ref|XP_010255797.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Nelumbo nucifera] Length = 343 Score = 82.0 bits (201), Expect = 2e-13 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = -2 Query: 514 SNGKTE--TEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 S+GK E ++ +K+D LMPDLCVICLEQEYN VFVPCGHMCCCTTC Sbjct: 275 SDGKAENGSDNTKRDRLMPDLCVICLEQEYNAVFVPCGHMCCCTTC 320 >gb|KNA20496.1| hypothetical protein SOVF_051850 [Spinacia oleracea] Length = 342 Score = 81.6 bits (200), Expect = 2e-13 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -2 Query: 517 DSNGKTETEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 D +G +K++CLMPDLCVICLE EYN VFVPCGHMCCCT C Sbjct: 275 DESGSDSANSAKRECLMPDLCVICLEHEYNAVFVPCGHMCCCTAC 319 >ref|XP_004290684.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Fragaria vesca subsp. vesca] Length = 342 Score = 80.9 bits (198), Expect = 3e-13 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = -2 Query: 496 TEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTCYL 377 +E KKD LMPDLCVICLEQEYN VFVPCGHMCCCTTC L Sbjct: 282 SEAPKKDRLMPDLCVICLEQEYNAVFVPCGHMCCCTTCSL 321 >ref|XP_010684326.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 338 Score = 80.5 bits (197), Expect = 5e-13 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 496 TEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 ++ K+DCLMPDLCVICLEQEYN VFVPCGHMCCCT C Sbjct: 278 SDSVKRDCLMPDLCVICLEQEYNAVFVPCGHMCCCTAC 315 >ref|XP_010684325.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X1 [Beta vulgaris subsp. vulgaris] gi|870854316|gb|KMT06107.1| hypothetical protein BVRB_7g163340 [Beta vulgaris subsp. vulgaris] Length = 339 Score = 80.5 bits (197), Expect = 5e-13 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 496 TEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 ++ K+DCLMPDLCVICLEQEYN VFVPCGHMCCCT C Sbjct: 279 SDSVKRDCLMPDLCVICLEQEYNAVFVPCGHMCCCTAC 316 >ref|XP_006850825.2| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 isoform X3 [Amborella trichopoda] Length = 343 Score = 79.3 bits (194), Expect = 1e-12 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 3/47 (6%) Frame = -2 Query: 514 SNGKTET---EKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 +NGK E K++C+MPDLCVICLEQ+YN VFVPCGHMCCCT+C Sbjct: 274 ANGKAEDGLEPNMKRECMMPDLCVICLEQQYNAVFVPCGHMCCCTSC 320 >ref|XP_011625708.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X1 [Amborella trichopoda] gi|769804090|ref|XP_011625709.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X2 [Amborella trichopoda] Length = 344 Score = 79.3 bits (194), Expect = 1e-12 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 3/47 (6%) Frame = -2 Query: 514 SNGKTET---EKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 +NGK E K++C+MPDLCVICLEQ+YN VFVPCGHMCCCT+C Sbjct: 275 ANGKAEDGLEPNMKRECMMPDLCVICLEQQYNAVFVPCGHMCCCTSC 321 >gb|KRH71473.1| hypothetical protein GLYMA_02G149800 [Glycine max] Length = 237 Score = 78.6 bits (192), Expect = 2e-12 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 484 KKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 KKD LMPDLCVICLEQEYN VFVPCGHMCCCTTC Sbjct: 181 KKDRLMPDLCVICLEQEYNAVFVPCGHMCCCTTC 214 >ref|XP_010473635.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Camelina sativa] Length = 343 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/46 (73%), Positives = 38/46 (82%), Gaps = 2/46 (4%) Frame = -2 Query: 514 SNGKTETE--KSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 SNG E+E +KK+ +PDLCVICLEQEYN VFVPCGHMCCCTTC Sbjct: 275 SNGARESELDSTKKEDAVPDLCVICLEQEYNAVFVPCGHMCCCTTC 320 >ref|XP_003518933.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Glycine max] gi|947123265|gb|KRH71471.1| hypothetical protein GLYMA_02G149800 [Glycine max] Length = 339 Score = 78.6 bits (192), Expect = 2e-12 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 484 KKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 KKD LMPDLCVICLEQEYN VFVPCGHMCCCTTC Sbjct: 283 KKDRLMPDLCVICLEQEYNAVFVPCGHMCCCTTC 316 >ref|XP_014514930.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Vigna radiata var. radiata] Length = 340 Score = 78.2 bits (191), Expect = 2e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -2 Query: 496 TEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 ++ +K+D LMPDLCVICLEQEYN VFVPCGHMCCCTTC Sbjct: 280 SDVAKRDRLMPDLCVICLEQEYNAVFVPCGHMCCCTTC 317 >ref|XP_010070254.1| PREDICTED: E3 ubiquitin-protein ligase cblA-like [Eucalyptus grandis] gi|629092911|gb|KCW58906.1| hypothetical protein EUGRSUZ_H01526 [Eucalyptus grandis] Length = 93 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = -2 Query: 517 DSNGKTETEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTCYL 377 D K + +K+D MPDLCVICLEQEYN VFVPCGHMCCCTTC L Sbjct: 26 DDKIKNAPDSAKRDRSMPDLCVICLEQEYNSVFVPCGHMCCCTTCSL 72 >ref|XP_002274008.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Vitis vinifera] gi|296086688|emb|CBI32323.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/45 (75%), Positives = 35/45 (77%) Frame = -2 Query: 517 DSNGKTETEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 D NG T K+D LMPDLCVICLEQEYN VFVPCGHMCCCT C Sbjct: 279 DENGSDNT---KRDRLMPDLCVICLEQEYNAVFVPCGHMCCCTMC 320 >emb|CAN61806.1| hypothetical protein VITISV_014293 [Vitis vinifera] Length = 558 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/45 (75%), Positives = 35/45 (77%) Frame = -2 Query: 517 DSNGKTETEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 D NG T K+D LMPDLCVICLEQEYN VFVPCGHMCCCT C Sbjct: 203 DENGSDNT---KRDRLMPDLCVICLEQEYNAVFVPCGHMCCCTMC 244 >ref|XP_009356733.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Pyrus x bretschneideri] Length = 342 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 5/52 (9%) Frame = -2 Query: 517 DSNGKTETEKS-----KKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTCYL 377 DS G E + S K+D +MP+LCVICLEQ+YN VFVPCGHMCCCTTC L Sbjct: 270 DSEGSNEKDDSASDGNKRDRMMPNLCVICLEQDYNAVFVPCGHMCCCTTCSL 321 >gb|KHN03773.1| Mitochondrial ubiquitin ligase activator of NFKB 1 [Glycine soja] Length = 339 Score = 77.4 bits (189), Expect = 4e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 496 TEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 ++ +KKD LMPDLCVICLEQEYN VFVPCGHMCCCT C Sbjct: 279 SDGAKKDRLMPDLCVICLEQEYNAVFVPCGHMCCCTAC 316 >ref|XP_008386573.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A [Malus domestica] Length = 342 Score = 77.4 bits (189), Expect = 4e-12 Identities = 33/48 (68%), Positives = 40/48 (83%), Gaps = 2/48 (4%) Frame = -2 Query: 514 SNGKTE--TEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTCYL 377 SN K + ++ +K+D +MPDLCVICLEQ+YN VFVPCGHMCCCTTC L Sbjct: 274 SNEKDDGASDGNKRDRMMPDLCVICLEQDYNAVFVPCGHMCCCTTCSL 321 >ref|XP_003536411.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 isoform 1 [Glycine max] gi|947083251|gb|KRH31972.1| hypothetical protein GLYMA_10G024100 [Glycine max] Length = 339 Score = 77.4 bits (189), Expect = 4e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 496 TEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 ++ +KKD LMPDLCVICLEQEYN VFVPCGHMCCCT C Sbjct: 279 SDGAKKDRLMPDLCVICLEQEYNAVFVPCGHMCCCTAC 316 >ref|XP_011079799.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Sesamum indicum] Length = 343 Score = 77.0 bits (188), Expect = 5e-12 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = -2 Query: 511 NGKTE--TEKSKKDCLMPDLCVICLEQEYNVVFVPCGHMCCCTTC 383 NGK E +E + KD +MPDLCVICLEQEYN VFVPCGHMCCC C Sbjct: 276 NGKAENRSESTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMAC 320