BLASTX nr result
ID: Papaver30_contig00023630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00023630 (481 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009354172.1| PREDICTED: LRR repeats and ubiquitin-like do... 94 5e-17 ref|XP_008355078.1| PREDICTED: LRR repeats and ubiquitin-like do... 94 5e-17 ref|XP_008354903.1| PREDICTED: LRR repeats and ubiquitin-like do... 94 5e-17 ref|XP_012838110.1| PREDICTED: LRR repeats and ubiquitin-like do... 91 4e-16 ref|XP_008235710.1| PREDICTED: LRR repeats and ubiquitin-like do... 90 7e-16 ref|XP_007205369.1| hypothetical protein PRUPE_ppa007247mg [Prun... 90 7e-16 gb|AFK47174.1| unknown [Medicago truncatula] 89 2e-15 ref|XP_008465271.1| PREDICTED: LRR repeats and ubiquitin-like do... 88 2e-15 ref|XP_004240413.1| PREDICTED: LRR repeats and ubiquitin-like do... 88 2e-15 ref|XP_007016951.1| Typical subtype, Leucine-rich repeat, Ubiqui... 88 3e-15 ref|XP_004500301.1| PREDICTED: LRR repeats and ubiquitin-like do... 88 3e-15 ref|XP_014489624.1| PREDICTED: LRR repeats and ubiquitin-like do... 87 4e-15 gb|KOM52637.1| hypothetical protein LR48_Vigan09g129600 [Vigna a... 87 4e-15 gb|KHN02097.1| LRR repeats and ubiquitin-like domain-containing ... 87 4e-15 ref|XP_003552940.1| PREDICTED: LRR repeats and ubiquitin-like do... 87 4e-15 gb|KJB20435.1| hypothetical protein B456_003G148100 [Gossypium r... 87 5e-15 ref|XP_012471662.1| PREDICTED: LRR repeats and ubiquitin-like do... 87 5e-15 gb|KHG29821.1| hypothetical protein F383_15066 [Gossypium arboreum] 87 5e-15 ref|XP_009399902.1| PREDICTED: plant intracellular Ras-group-rel... 87 5e-15 ref|XP_009399901.1| PREDICTED: plant intracellular Ras-group-rel... 87 5e-15 >ref|XP_009354172.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Pyrus x bretschneideri] Length = 377 Score = 93.6 bits (231), Expect = 5e-17 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 L+TLDLHNTEIT+D+L QFEGWESFDERRRLKHQKQL F V +SG FDEGADK Sbjct: 324 LTTLDLHNTEITVDVLRQFEGWESFDERRRLKHQKQLDFRVVNSGAFDEGADK 376 >ref|XP_008355078.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Malus domestica] Length = 377 Score = 93.6 bits (231), Expect = 5e-17 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 L+TLDLHNTEIT+D+L QFEGWESFDERRRLKHQKQL F V +SG FDEGADK Sbjct: 324 LTTLDLHNTEITVDVLRQFEGWESFDERRRLKHQKQLDFRVVNSGAFDEGADK 376 >ref|XP_008354903.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Malus domestica] Length = 377 Score = 93.6 bits (231), Expect = 5e-17 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 L+TLDLHNTEIT+D+L QFEGWESFDERRRLKHQKQL F V +SG FDEGADK Sbjct: 324 LTTLDLHNTEITVDVLRQFEGWESFDERRRLKHQKQLDFRVVNSGAFDEGADK 376 >ref|XP_012838110.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Erythranthe guttatus] Length = 367 Score = 90.5 bits (223), Expect = 4e-16 Identities = 44/53 (83%), Positives = 45/53 (84%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 LSTLDLHNTEIT D+L QFEGWESFDERRRLKHQKQL F V S FDEGADK Sbjct: 313 LSTLDLHNTEITTDLLRQFEGWESFDERRRLKHQKQLDFRVSGSAEFDEGADK 365 >ref|XP_008235710.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Prunus mume] Length = 405 Score = 89.7 bits (221), Expect = 7e-16 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 L+TLDLHNTEIT+D+L Q EGWESFDERRRLKHQKQL F V +SG FDEGADK Sbjct: 352 LTTLDLHNTEITMDVLRQTEGWESFDERRRLKHQKQLDFRVVNSGAFDEGADK 404 >ref|XP_007205369.1| hypothetical protein PRUPE_ppa007247mg [Prunus persica] gi|462401011|gb|EMJ06568.1| hypothetical protein PRUPE_ppa007247mg [Prunus persica] Length = 376 Score = 89.7 bits (221), Expect = 7e-16 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 L+TLDLHNTEIT+D+L Q EGWESFDERRRLKHQKQL F V +SG FDEGADK Sbjct: 323 LTTLDLHNTEITMDVLRQTEGWESFDERRRLKHQKQLDFRVVNSGAFDEGADK 375 >gb|AFK47174.1| unknown [Medicago truncatula] Length = 372 Score = 88.6 bits (218), Expect = 2e-15 Identities = 43/53 (81%), Positives = 46/53 (86%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 LSTLDLHNTEITIDIL +FEGW+SFDERRR KHQKQ+ F VG S FDEGADK Sbjct: 319 LSTLDLHNTEITIDILREFEGWDSFDERRRSKHQKQIEFRVGVSRDFDEGADK 371 >ref|XP_008465271.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Cucumis melo] Length = 378 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/54 (77%), Positives = 47/54 (87%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADKY 320 LSTLDLHNTEITID+L Q+EGWE+FDERRRLKHQKQL F V + FDEGADK+ Sbjct: 325 LSTLDLHNTEITIDLLRQYEGWEAFDERRRLKHQKQLDFRVMNQADFDEGADKH 378 >ref|XP_004240413.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Solanum lycopersicum] Length = 375 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 LSTLDLH TEITID++SQ EGWE+FDERRR KHQKQL F V SSG FDEGAD+ Sbjct: 322 LSTLDLHGTEITIDVISQIEGWENFDERRRSKHQKQLDFRVSSSGKFDEGADQ 374 >ref|XP_007016951.1| Typical subtype, Leucine-rich repeat, Ubiquitin, Ubiquitin supergroup isoform 1 [Theobroma cacao] gi|508787314|gb|EOY34570.1| Typical subtype, Leucine-rich repeat, Ubiquitin, Ubiquitin supergroup isoform 1 [Theobroma cacao] Length = 373 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/53 (79%), Positives = 45/53 (84%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 L+TLDLHNTEIT+D+L QFEGWE FDERRR KHQKQL F V SS FDEGADK Sbjct: 320 LATLDLHNTEITMDVLRQFEGWEEFDERRRSKHQKQLDFRVVSSAAFDEGADK 372 >ref|XP_004500301.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Cicer arietinum] Length = 374 Score = 87.8 bits (216), Expect = 3e-15 Identities = 43/53 (81%), Positives = 45/53 (84%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 LSTLDLHNTEITID+L QFEGW+ FDERRR KHQKQL F VG S FDEGADK Sbjct: 321 LSTLDLHNTEITIDLLRQFEGWDDFDERRRSKHQKQLDFRVGVSRDFDEGADK 373 >ref|XP_014489624.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Vigna radiata var. radiata] Length = 369 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 LSTLDLHNTEITID+L QFEGW++FDERRR KHQKQ+ F VG S FDEGADK Sbjct: 316 LSTLDLHNTEITIDLLRQFEGWDNFDERRRSKHQKQIDFRVGVSRDFDEGADK 368 >gb|KOM52637.1| hypothetical protein LR48_Vigan09g129600 [Vigna angularis] Length = 369 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 LSTLDLHNTEITID+L QFEGW++FDERRR KHQKQ+ F VG S FDEGADK Sbjct: 316 LSTLDLHNTEITIDLLRQFEGWDNFDERRRSKHQKQIDFRVGVSRDFDEGADK 368 >gb|KHN02097.1| LRR repeats and ubiquitin-like domain-containing protein [Glycine soja] Length = 375 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 LSTLDLHNTEITID+L QFEGW++FDERRR KHQKQ+ F VG S FDEGADK Sbjct: 322 LSTLDLHNTEITIDLLRQFEGWDNFDERRRSKHQKQIDFRVGVSRDFDEGADK 374 >ref|XP_003552940.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105-like [Glycine max] gi|947048706|gb|KRG98234.1| hypothetical protein GLYMA_18G059000 [Glycine max] Length = 375 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 LSTLDLHNTEITID+L QFEGW++FDERRR KHQKQ+ F VG S FDEGADK Sbjct: 322 LSTLDLHNTEITIDLLRQFEGWDNFDERRRSKHQKQIDFRVGVSRDFDEGADK 374 >gb|KJB20435.1| hypothetical protein B456_003G148100 [Gossypium raimondii] Length = 310 Score = 87.0 bits (214), Expect = 5e-15 Identities = 42/53 (79%), Positives = 45/53 (84%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 L+TLDLHNTEIT+D+L QFEGWE FDERRR KHQKQL F V SS FDEGADK Sbjct: 257 LATLDLHNTEITMDVLRQFEGWEEFDERRRSKHQKQLDFRVVSSAQFDEGADK 309 >ref|XP_012471662.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 isoform X2 [Gossypium raimondii] gi|763753044|gb|KJB20432.1| hypothetical protein B456_003G148100 [Gossypium raimondii] Length = 373 Score = 87.0 bits (214), Expect = 5e-15 Identities = 42/53 (79%), Positives = 45/53 (84%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 L+TLDLHNTEIT+D+L QFEGWE FDERRR KHQKQL F V SS FDEGADK Sbjct: 320 LATLDLHNTEITMDVLRQFEGWEEFDERRRSKHQKQLDFRVVSSAQFDEGADK 372 >gb|KHG29821.1| hypothetical protein F383_15066 [Gossypium arboreum] Length = 373 Score = 87.0 bits (214), Expect = 5e-15 Identities = 42/53 (79%), Positives = 45/53 (84%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGADK 323 L+TLDLHNTEIT+D+L QFEGWE FDERRR KHQKQL F V SS FDEGADK Sbjct: 320 LATLDLHNTEITMDVLRQFEGWEEFDERRRSKHQKQLDFRVVSSAQFDEGADK 372 >ref|XP_009399902.1| PREDICTED: plant intracellular Ras-group-related LRR protein 8 isoform X2 [Musa acuminata subsp. malaccensis] Length = 358 Score = 87.0 bits (214), Expect = 5e-15 Identities = 43/52 (82%), Positives = 43/52 (82%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGAD 326 LSTLDLH TEIT D L Q EGWE FDERRR KHQKQL F VGSSGVFDEGAD Sbjct: 301 LSTLDLHGTEITNDFLRQIEGWEDFDERRRSKHQKQLDFRVGSSGVFDEGAD 352 >ref|XP_009399901.1| PREDICTED: plant intracellular Ras-group-related LRR protein 8 isoform X1 [Musa acuminata subsp. malaccensis] Length = 380 Score = 87.0 bits (214), Expect = 5e-15 Identities = 43/52 (82%), Positives = 43/52 (82%) Frame = -1 Query: 481 LSTLDLHNTEITIDILSQFEGWESFDERRRLKHQKQLYF*VGSSGVFDEGAD 326 LSTLDLH TEIT D L Q EGWE FDERRR KHQKQL F VGSSGVFDEGAD Sbjct: 323 LSTLDLHGTEITNDFLRQIEGWEDFDERRRSKHQKQLDFRVGSSGVFDEGAD 374