BLASTX nr result
ID: Papaver30_contig00023390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00023390 (666 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010279112.1| PREDICTED: TPR repeat-containing thioredoxin... 66 2e-08 ref|XP_010277047.1| PREDICTED: TPR repeat-containing thioredoxin... 66 2e-08 ref|XP_010277046.1| PREDICTED: TPR repeat-containing thioredoxin... 66 2e-08 ref|XP_009396638.1| PREDICTED: TPR repeat-containing thioredoxin... 62 2e-07 ref|XP_006852428.2| PREDICTED: TPR repeat-containing thioredoxin... 61 5e-07 ref|XP_009410829.1| PREDICTED: TPR repeat-containing thioredoxin... 61 5e-07 gb|ERN13895.1| hypothetical protein AMTR_s00021p00076440 [Ambore... 61 5e-07 gb|KMZ58246.1| Tetratricopeptide repeat protein 2-like [Zostera ... 60 9e-07 gb|KOM49547.1| hypothetical protein LR48_Vigan08g037400 [Vigna a... 60 1e-06 ref|XP_009386632.1| PREDICTED: TPR repeat-containing thioredoxin... 60 2e-06 ref|XP_009393078.1| PREDICTED: TPR repeat-containing thioredoxin... 60 2e-06 ref|XP_002317465.1| tetratricopeptide repeat-containing family p... 60 2e-06 ref|XP_014494330.1| PREDICTED: TPR repeat-containing thioredoxin... 59 2e-06 gb|KHN37980.1| TPR repeat-containing thioredoxin TTL1 [Glycine s... 59 2e-06 ref|XP_007133199.1| hypothetical protein PHAVU_011G160000g [Phas... 59 2e-06 ref|XP_004968637.1| PREDICTED: TPR repeat-containing thioredoxin... 59 2e-06 ref|XP_003556806.1| PREDICTED: TPR repeat-containing thioredoxin... 59 2e-06 ref|XP_002457127.1| hypothetical protein SORBIDRAFT_03g001720 [S... 59 2e-06 ref|XP_011016487.1| PREDICTED: TPR repeat-containing thioredoxin... 59 3e-06 ref|XP_011029559.1| PREDICTED: TPR repeat-containing thioredoxin... 59 3e-06 >ref|XP_010279112.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Nelumbo nucifera] Length = 716 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKEMICPSHQVLEYSVRHYSL Sbjct: 686 TFKIYKNGSRVKEMICPSHQVLEYSVRHYSL 716 >ref|XP_010277047.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X2 [Nelumbo nucifera] Length = 713 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKEMICPSHQVLEYSVRHYSL Sbjct: 683 TFKIYKNGSRVKEMICPSHQVLEYSVRHYSL 713 >ref|XP_010277046.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X1 [Nelumbo nucifera] Length = 716 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKEMICPSHQVLEYSVRHYSL Sbjct: 686 TFKIYKNGSRVKEMICPSHQVLEYSVRHYSL 716 >ref|XP_009396638.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Musa acuminata subsp. malaccensis] Length = 708 Score = 62.4 bits (150), Expect = 2e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKEMICPS QVLEYSVRHYSL Sbjct: 678 TFKIYKNGIRVKEMICPSQQVLEYSVRHYSL 708 >ref|XP_006852428.2| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Amborella trichopoda] Length = 658 Score = 61.2 bits (147), Expect = 5e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKEMICP+ QVLEYSVRHYSL Sbjct: 628 TFKIYKNGCRVKEMICPTEQVLEYSVRHYSL 658 >ref|XP_009410829.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Musa acuminata subsp. malaccensis] Length = 688 Score = 61.2 bits (147), Expect = 5e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKEMICPS QVLEYSVRHY L Sbjct: 658 TFKIYKNGTRVKEMICPSQQVLEYSVRHYGL 688 >gb|ERN13895.1| hypothetical protein AMTR_s00021p00076440 [Amborella trichopoda] Length = 671 Score = 61.2 bits (147), Expect = 5e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKEMICP+ QVLEYSVRHYSL Sbjct: 641 TFKIYKNGCRVKEMICPTEQVLEYSVRHYSL 671 >gb|KMZ58246.1| Tetratricopeptide repeat protein 2-like [Zostera marina] Length = 705 Score = 60.5 bits (145), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKEMICPS QVLE+SVRHY+L Sbjct: 675 TFKIYKNGSRVKEMICPSQQVLEFSVRHYAL 705 >gb|KOM49547.1| hypothetical protein LR48_Vigan08g037400 [Vigna angularis] Length = 679 Score = 60.1 bits (144), Expect = 1e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKE+ICPSH++LE+S+RHYSL Sbjct: 649 TFKIYKNGSRVKEIICPSHEMLEHSIRHYSL 679 >ref|XP_009386632.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 701 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKEMICPS QVLE SVRHYSL Sbjct: 671 TFKIYKNGKRVKEMICPSQQVLENSVRHYSL 701 >ref|XP_009393078.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Musa acuminata subsp. malaccensis] Length = 675 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYK+G R+KEMICPS QVLEYSVRHYSL Sbjct: 645 TFKIYKSGTRMKEMICPSQQVLEYSVRHYSL 675 >ref|XP_002317465.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] gi|222860530|gb|EEE98077.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] Length = 698 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYS 577 TFKIYKNG+RVKE++CPSH VLE+SVRHYS Sbjct: 668 TFKIYKNGNRVKEIVCPSHDVLEHSVRHYS 697 >ref|XP_014494330.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Vigna radiata var. radiata] Length = 684 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKE+ICPSH +LE+S+RHYSL Sbjct: 654 TFKIYKNGSRVKEIICPSHDMLEHSIRHYSL 684 >gb|KHN37980.1| TPR repeat-containing thioredoxin TTL1 [Glycine soja] Length = 465 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKE+ICPSH +LE+S+RHYSL Sbjct: 435 TFKIYKNGSRVKEIICPSHDMLEHSIRHYSL 465 >ref|XP_007133199.1| hypothetical protein PHAVU_011G160000g [Phaseolus vulgaris] gi|561006199|gb|ESW05193.1| hypothetical protein PHAVU_011G160000g [Phaseolus vulgaris] Length = 679 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKE+ICPSH +LE+S+RHYSL Sbjct: 649 TFKIYKNGSRVKEIICPSHDMLEHSIRHYSL 679 >ref|XP_004968637.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Setaria italica] gi|944240665|gb|KQL04973.1| hypothetical protein SETIT_000561mg [Setaria italica] Length = 677 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKEMICPS Q+LEYSVRHY + Sbjct: 647 TFKIYKNGMRVKEMICPSQQLLEYSVRHYGI 677 >ref|XP_003556806.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] gi|947077383|gb|KRH26223.1| hypothetical protein GLYMA_12G160800 [Glycine max] Length = 676 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKE+ICPSH +LE+S+RHYSL Sbjct: 646 TFKIYKNGSRVKEIICPSHDMLEHSIRHYSL 676 >ref|XP_002457127.1| hypothetical protein SORBIDRAFT_03g001720 [Sorghum bicolor] gi|241929102|gb|EES02247.1| hypothetical protein SORBIDRAFT_03g001720 [Sorghum bicolor] Length = 684 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYSL 574 TFKIYKNG RVKEMICPS Q+LEYSVRHY + Sbjct: 654 TFKIYKNGMRVKEMICPSQQLLEYSVRHYGI 684 >ref|XP_011016487.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X2 [Populus euphratica] Length = 681 Score = 58.9 bits (141), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYS 577 TFKIYKNG+RVKEM+CPSH VLE+SVR+YS Sbjct: 651 TFKIYKNGNRVKEMVCPSHDVLEHSVRYYS 680 >ref|XP_011029559.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X2 [Populus euphratica] Length = 681 Score = 58.9 bits (141), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 666 TFKIYKNGHRVKEMICPSHQVLEYSVRHYS 577 TFKIYKNG+RVKEM+CPSH VLE+SVR+YS Sbjct: 651 TFKIYKNGNRVKEMVCPSHDVLEHSVRYYS 680