BLASTX nr result
ID: Papaver30_contig00018376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00018376 (772 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078903.1| PREDICTED: leucine-rich repeat receptor-like... 72 1e-17 ref|XP_010257159.1| PREDICTED: leucine-rich repeat receptor-like... 71 7e-17 ref|XP_002278051.2| PREDICTED: leucine-rich repeat receptor-like... 71 7e-17 emb|CAN69090.1| hypothetical protein VITISV_009158 [Vitis vinifera] 71 7e-17 emb|CBI29847.3| unnamed protein product [Vitis vinifera] 71 7e-17 ref|XP_010241210.1| PREDICTED: leucine-rich repeat receptor-like... 72 2e-16 ref|XP_010241211.1| PREDICTED: leucine-rich repeat receptor-like... 72 2e-16 ref|XP_012857257.1| PREDICTED: leucine-rich repeat receptor-like... 71 2e-16 ref|XP_009610876.1| PREDICTED: leucine-rich repeat receptor-like... 69 2e-16 gb|EYU20745.1| hypothetical protein MIMGU_mgv1a001276mg [Erythra... 71 2e-16 ref|XP_006350199.1| PREDICTED: leucine-rich repeat receptor-like... 69 5e-16 ref|XP_004236615.1| PREDICTED: leucine-rich repeat receptor-like... 69 5e-16 ref|XP_009789116.1| PREDICTED: leucine-rich repeat receptor-like... 68 5e-16 ref|XP_006489937.1| PREDICTED: leucine-rich repeat receptor-like... 68 5e-16 ref|XP_006421411.1| hypothetical protein CICLE_v100042991mg, par... 68 5e-16 ref|XP_010546603.1| PREDICTED: leucine-rich repeat receptor-like... 68 9e-16 ref|XP_011075242.1| PREDICTED: leucine-rich repeat receptor-like... 71 9e-16 ref|XP_010554836.1| PREDICTED: leucine-rich repeat receptor-like... 66 9e-16 ref|XP_011015844.1| PREDICTED: leucine-rich repeat receptor-like... 67 9e-16 ref|XP_011033329.1| PREDICTED: leucine-rich repeat receptor-like... 67 9e-16 >ref|XP_011078903.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Sesamum indicum] Length = 889 Score = 71.6 bits (174), Expect(2) = 1e-17 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPA 356 E+FGEGIDLVK WVH AP RG TPEQILD+RLST+SFAW K+M A Sbjct: 814 EAFGEGIDLVK---WVHTAPTRGETPEQILDARLSTVSFAWRKEMLA 857 Score = 45.8 bits (107), Expect(2) = 1e-17 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTDTTPAKR KMKK+VE+LQE+ Sbjct: 863 LLCTDTTPAKRPKMKKVVEMLQEI 886 >ref|XP_010257159.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Nelumbo nucifera] gi|720003943|ref|XP_010257160.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Nelumbo nucifera] Length = 889 Score = 70.9 bits (172), Expect(2) = 7e-17 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPAL 359 E+FGEGIDLVK WVH AP RG TPEQILD+RLST+SFAW K+M A+ Sbjct: 814 EAFGEGIDLVK---WVHGAPARGETPEQILDARLSTVSFAWRKEMLAV 858 Score = 44.3 bits (103), Expect(2) = 7e-17 Identities = 19/24 (79%), Positives = 23/24 (95%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD+TPAKR KMKK+VE+LQE+ Sbjct: 863 LLCTDSTPAKRPKMKKVVEMLQEI 886 >ref|XP_002278051.2| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Vitis vinifera] Length = 888 Score = 71.2 bits (173), Expect(2) = 7e-17 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQM 350 E+FGEGIDLVK WVH AP RG TPEQILD+RLST+SFAW K+M Sbjct: 813 EAFGEGIDLVK---WVHTAPARGETPEQILDARLSTVSFAWRKEM 854 Score = 43.9 bits (102), Expect(2) = 7e-17 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD TPAKR KMKK+VE+LQE+ Sbjct: 862 LLCTDNTPAKRPKMKKVVEMLQEI 885 >emb|CAN69090.1| hypothetical protein VITISV_009158 [Vitis vinifera] Length = 887 Score = 71.2 bits (173), Expect(2) = 7e-17 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQM 350 E+FGEGIDLVK WVH AP RG TPEQILD+RLST+SFAW K+M Sbjct: 812 EAFGEGIDLVK---WVHTAPARGETPEQILDARLSTVSFAWRKEM 853 Score = 43.9 bits (102), Expect(2) = 7e-17 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD TPAKR KMKK+VE+LQE+ Sbjct: 861 LLCTDNTPAKRPKMKKVVEMLQEI 884 >emb|CBI29847.3| unnamed protein product [Vitis vinifera] Length = 806 Score = 71.2 bits (173), Expect(2) = 7e-17 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQM 350 E+FGEGIDLVK WVH AP RG TPEQILD+RLST+SFAW K+M Sbjct: 731 EAFGEGIDLVK---WVHTAPARGETPEQILDARLSTVSFAWRKEM 772 Score = 43.9 bits (102), Expect(2) = 7e-17 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD TPAKR KMKK+VE+LQE+ Sbjct: 780 LLCTDNTPAKRPKMKKVVEMLQEI 803 >ref|XP_010241210.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 isoform X1 [Nelumbo nucifera] Length = 912 Score = 71.6 bits (174), Expect(2) = 2e-16 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPAL 359 E+FGEG+DLVK WVH AP RG TPEQILD+RLST+SFAW K+M AL Sbjct: 837 EAFGEGVDLVK---WVHGAPARGETPEQILDARLSTVSFAWRKEMLAL 881 Score = 42.0 bits (97), Expect(2) = 2e-16 Identities = 18/24 (75%), Positives = 22/24 (91%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD+ PAKR KMKK+VE+LQE+ Sbjct: 886 LLCTDSIPAKRPKMKKVVEMLQEI 909 >ref|XP_010241211.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 isoform X2 [Nelumbo nucifera] Length = 878 Score = 71.6 bits (174), Expect(2) = 2e-16 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPAL 359 E+FGEG+DLVK WVH AP RG TPEQILD+RLST+SFAW K+M AL Sbjct: 803 EAFGEGVDLVK---WVHGAPARGETPEQILDARLSTVSFAWRKEMLAL 847 Score = 42.0 bits (97), Expect(2) = 2e-16 Identities = 18/24 (75%), Positives = 22/24 (91%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD+ PAKR KMKK+VE+LQE+ Sbjct: 852 LLCTDSIPAKRPKMKKVVEMLQEI 875 >ref|XP_012857257.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase PXC3 [Erythranthe guttatus] Length = 892 Score = 71.2 bits (173), Expect(2) = 2e-16 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPA 356 E+FGEGIDLVK WVH AP RG TPEQILD+RLST+SFAW K+M A Sbjct: 817 EAFGEGIDLVK---WVHTAPMRGETPEQILDARLSTVSFAWRKEMLA 860 Score = 42.0 bits (97), Expect(2) = 2e-16 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEVNYT 432 LLCTD+TPAKR KMK +VE+L+E+ T Sbjct: 866 LLCTDSTPAKRPKMKTVVEMLREITQT 892 >ref|XP_009610876.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Nicotiana tomentosiformis] Length = 892 Score = 69.3 bits (168), Expect(2) = 2e-16 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPA 356 E FGEGIDLVK WVH AP RG TPEQILD+RLSTISF+W K+M A Sbjct: 817 EDFGEGIDLVK---WVHGAPARGETPEQILDARLSTISFSWRKEMLA 860 Score = 43.9 bits (102), Expect(2) = 2e-16 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD TPAKR KMKK+VE+LQE+ Sbjct: 866 LLCTDVTPAKRPKMKKVVEMLQEI 889 >gb|EYU20745.1| hypothetical protein MIMGU_mgv1a001276mg [Erythranthe guttata] Length = 848 Score = 71.2 bits (173), Expect(2) = 2e-16 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPA 356 E+FGEGIDLVK WVH AP RG TPEQILD+RLST+SFAW K+M A Sbjct: 773 EAFGEGIDLVK---WVHTAPMRGETPEQILDARLSTVSFAWRKEMLA 816 Score = 42.0 bits (97), Expect(2) = 2e-16 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEVNYT 432 LLCTD+TPAKR KMK +VE+L+E+ T Sbjct: 822 LLCTDSTPAKRPKMKTVVEMLREITQT 848 >ref|XP_006350199.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820-like [Solanum tuberosum] Length = 894 Score = 68.6 bits (166), Expect(2) = 5e-16 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPA 356 E+FGEGIDLVK WVH AP RG TPEQILD++LSTISF+W K+M A Sbjct: 819 EAFGEGIDLVK---WVHGAPTRGETPEQILDAKLSTISFSWRKEMLA 862 Score = 43.5 bits (101), Expect(2) = 5e-16 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD TPAKR KMKK+VE+LQE+ Sbjct: 868 LLCTDMTPAKRPKMKKVVEMLQEI 891 >ref|XP_004236615.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Solanum lycopersicum] gi|723688909|ref|XP_010319189.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Solanum lycopersicum] gi|723688912|ref|XP_010319190.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Solanum lycopersicum] Length = 894 Score = 68.6 bits (166), Expect(2) = 5e-16 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPA 356 E+FGEGIDLVK WVH AP RG TPEQILD++LSTISF+W K+M A Sbjct: 819 EAFGEGIDLVK---WVHGAPARGETPEQILDAKLSTISFSWRKEMLA 862 Score = 43.5 bits (101), Expect(2) = 5e-16 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD TPAKR KMKK+VE+LQE+ Sbjct: 868 LLCTDMTPAKRPKMKKVVEMLQEI 891 >ref|XP_009789116.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Nicotiana sylvestris] Length = 892 Score = 68.2 bits (165), Expect(2) = 5e-16 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPA 356 + FGEGIDLVK WVH AP RG TPEQILD+RLSTISF+W K+M A Sbjct: 817 DDFGEGIDLVK---WVHGAPTRGETPEQILDARLSTISFSWRKEMLA 860 Score = 43.9 bits (102), Expect(2) = 5e-16 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD TPAKR KMKK+VE+LQE+ Sbjct: 866 LLCTDVTPAKRPKMKKVVEMLQEI 889 >ref|XP_006489937.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820-like [Citrus sinensis] gi|641834685|gb|KDO53674.1| hypothetical protein CISIN_1g002721mg [Citrus sinensis] Length = 888 Score = 67.8 bits (164), Expect(2) = 5e-16 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQM 350 E FGEG+DLVK WVH AP RG TPEQILD+RLST+SF W K+M Sbjct: 813 EDFGEGVDLVK---WVHGAPARGETPEQILDARLSTVSFGWRKEM 854 Score = 44.3 bits (103), Expect(2) = 5e-16 Identities = 19/24 (79%), Positives = 23/24 (95%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD+TPAKR KMKK+VE+LQE+ Sbjct: 862 LLCTDSTPAKRPKMKKVVEMLQEI 885 >ref|XP_006421411.1| hypothetical protein CICLE_v100042991mg, partial [Citrus clementina] gi|557523284|gb|ESR34651.1| hypothetical protein CICLE_v100042991mg, partial [Citrus clementina] Length = 500 Score = 67.8 bits (164), Expect(2) = 5e-16 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQM 350 E FGEG+DLVK WVH AP RG TPEQILD+RLST+SF W K+M Sbjct: 425 EDFGEGVDLVK---WVHGAPARGETPEQILDARLSTVSFGWRKEM 466 Score = 44.3 bits (103), Expect(2) = 5e-16 Identities = 19/24 (79%), Positives = 23/24 (95%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD+TPAKR KMKK+VE+LQE+ Sbjct: 474 LLCTDSTPAKRPKMKKVVEMLQEI 497 >ref|XP_010546603.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Tarenaya hassleriana] Length = 899 Score = 68.2 bits (165), Expect(2) = 9e-16 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPA 356 E FGEG+DLVK WVH P RG TPEQILDSRLST+SFAW ++M A Sbjct: 813 EEFGEGVDLVK---WVHGGPARGETPEQILDSRLSTVSFAWRREMLA 856 Score = 43.1 bits (100), Expect(2) = 9e-16 Identities = 18/28 (64%), Positives = 24/28 (85%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEVNYTR 435 LLCTD TPAKR KMK++VE+LQE+ ++ Sbjct: 862 LLCTDLTPAKRPKMKRVVEMLQEIKQSK 889 >ref|XP_011075242.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Sesamum indicum] Length = 889 Score = 70.9 bits (172), Expect(2) = 9e-16 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPA 356 E+FGEG+DLVK WVH AP RG TPEQILD+RLST+SFAW K+M A Sbjct: 814 EAFGEGVDLVK---WVHSAPARGETPEQILDARLSTVSFAWRKEMLA 857 Score = 40.4 bits (93), Expect(2) = 9e-16 Identities = 17/24 (70%), Positives = 22/24 (91%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD+TPAKR KMK +VE+L+E+ Sbjct: 863 LLCTDSTPAKRPKMKTVVEMLKEI 886 >ref|XP_010554836.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Tarenaya hassleriana] Length = 889 Score = 66.2 bits (160), Expect(2) = 9e-16 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQM 350 E FGEG+DLVK WVH A RG TPEQILD+RLST+SFAW K+M Sbjct: 813 EEFGEGVDLVK---WVHGASARGETPEQILDARLSTVSFAWRKEM 854 Score = 45.1 bits (105), Expect(2) = 9e-16 Identities = 20/35 (57%), Positives = 26/35 (74%) Frame = +1 Query: 331 LLGRNKCLLCTDTTPAKRLKMKKIVELLQEVNYTR 435 L+ LLCTD TPAKR KMKK+VE+LQE+ ++ Sbjct: 855 LMALKVALLCTDITPAKRPKMKKVVEMLQEIKQSK 889 >ref|XP_011015844.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Populus euphratica] Length = 888 Score = 67.0 bits (162), Expect(2) = 9e-16 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPA 356 E FGEG+DLVK WVH AP RG TPEQILD+RLST+SF W ++M A Sbjct: 813 EDFGEGVDLVK---WVHGAPARGETPEQILDARLSTVSFGWRREMLA 856 Score = 44.3 bits (103), Expect(2) = 9e-16 Identities = 19/24 (79%), Positives = 23/24 (95%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD+TPAKR KMKK+VE+LQE+ Sbjct: 862 LLCTDSTPAKRPKMKKVVEMLQEI 885 >ref|XP_011033329.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Populus euphratica] Length = 888 Score = 67.0 bits (162), Expect(2) = 9e-16 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = +3 Query: 216 ESFGEGIDLVKSLKWVHIAPERGYTPEQILDSRLSTISFAWTKQMPA 356 E FGEG+DLVK WVH AP RG TPEQILD+RLST+SF W ++M A Sbjct: 813 EDFGEGVDLVK---WVHGAPARGETPEQILDARLSTVSFGWRREMLA 856 Score = 44.3 bits (103), Expect(2) = 9e-16 Identities = 19/24 (79%), Positives = 23/24 (95%) Frame = +1 Query: 352 LLCTDTTPAKRLKMKKIVELLQEV 423 LLCTD+TPAKR KMKK+VE+LQE+ Sbjct: 862 LLCTDSTPAKRPKMKKVVEMLQEI 885