BLASTX nr result
ID: Papaver30_contig00018167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00018167 (948 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM30725.1| hypothetical protein LR48_Vigan01g027900 [Vigna a... 53 8e-06 >gb|KOM30725.1| hypothetical protein LR48_Vigan01g027900 [Vigna angularis] Length = 618 Score = 52.8 bits (125), Expect(2) = 8e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 415 RLIGFCTTQSESLLIYPSVQNLIVAYRLRVLQY 317 RLIGFCTT +E LL+YP +QNL VAYRLRV+ Y Sbjct: 344 RLIGFCTTPTERLLVYPFMQNLSVAYRLRVMVY 376 Score = 25.4 bits (54), Expect(2) = 8e-06 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 507 DNTKIDVKQLKDLQSP 460 DNTK+ VK+L D +SP Sbjct: 306 DNTKVAVKRLTDYESP 321