BLASTX nr result
ID: Papaver30_contig00016381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00016381 (2772 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB10365.1| hypothetical protein B456_001G220700 [Gossypium r... 62 4e-06 >gb|KJB10365.1| hypothetical protein B456_001G220700 [Gossypium raimondii] Length = 77 Score = 61.6 bits (148), Expect = 4e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 1460 LSLRTRDLSQSIPLPLILRESERSFSSLNLFVWN 1561 L +RTRDLSQSIPLP ILRESERS SSLNLF+WN Sbjct: 30 LIIRTRDLSQSIPLPFILRESERSLSSLNLFIWN 63