BLASTX nr result
ID: Papaver30_contig00016005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00016005 (2173 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006345318.1| PREDICTED: uncharacterized protein LOC102581... 62 2e-06 >ref|XP_006345318.1| PREDICTED: uncharacterized protein LOC102581842 [Solanum tuberosum] Length = 278 Score = 62.4 bits (150), Expect = 2e-06 Identities = 44/191 (23%), Positives = 92/191 (48%) Frame = -2 Query: 1161 DYNLSMLGRICSPITISTSRVRKLVRDNWPMFREVSINKFGATLNVHLYKFGSEIDIMRI 982 D +S+ G++ S + V+ + W + I + G N +KF + + ++ Sbjct: 35 DCEVSLFGKVVSDKKVDLQGVKNTMPVAWGNPTGLQIKEIG--WNFFQFKFKDKEGMNKV 92 Query: 981 KYDGPWVLDGYLVVLIEIPILGFQFGASINMDYEIFIVFM*RIPNEFLTPAAYRVMASAV 802 + PW+ D +L+ I+I G + +SI E+++ IP +++ R + +A+ Sbjct: 93 LFGTPWLYDKFLLN-IQIWEPGLKSTSSIFNVCELWVQVW-NIPLHWMSMDVGRKIGNAL 150 Query: 801 GELCGLAEPMGLSQDHKTVKMLIKINVTGSLPRLVLVKAQYDEAWVSVNYNVMPRRICQV 622 G + + P S++ + ++ ++N+T LPR L+K + WV ++Y +P +C Sbjct: 151 GGIVDIVIPENGSKEGQYIRPKARMNITKPLPRGKLIKLGSETTWVEISYENLP-YVCYY 209 Query: 621 CRVLDHRVEPC 589 C +L H + C Sbjct: 210 CGLLGHNEKTC 220