BLASTX nr result
ID: Papaver30_contig00013485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00013485 (1127 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008223373.1| PREDICTED: GDSL esterase/lipase At4g16230-li... 39 8e-06 >ref|XP_008223373.1| PREDICTED: GDSL esterase/lipase At4g16230-like [Prunus mume] Length = 370 Score = 39.3 bits (90), Expect(2) = 8e-06 Identities = 15/30 (50%), Positives = 26/30 (86%) Frame = -3 Query: 507 IAIPEPKMLTPEMFVGLLISRFKLEVRALY 418 I+IPE K+++PE+FV +LIS+++L++ LY Sbjct: 185 ISIPEQKLISPEVFVAILISKYRLQLTRLY 214 Score = 39.3 bits (90), Expect(2) = 8e-06 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -1 Query: 410 LYKTGARKIIVANVGPVVCMPLEK 339 LY GA+KIIVANVGP+ C+P E+ Sbjct: 213 LYNLGAKKIIVANVGPIGCIPFER 236