BLASTX nr result
ID: Papaver30_contig00008571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00008571 (489 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010260257.1| PREDICTED: 30S ribosomal protein S5, chlorop... 57 7e-06 >ref|XP_010260257.1| PREDICTED: 30S ribosomal protein S5, chloroplastic [Nelumbo nucifera] Length = 319 Score = 56.6 bits (135), Expect = 7e-06 Identities = 37/91 (40%), Positives = 53/91 (58%), Gaps = 1/91 (1%) Frame = -3 Query: 271 PNHTSFSFSNIKTHKLITPIS-SLKFPHSKSQKPKPIKATPSDAETIFMENEINPDEDFT 95 P T+F+FS +KT K I + SL F SK K +P +A +D +T F + +++P+ D T Sbjct: 31 PLTTNFAFSLVKTSKPIPSTTCSLSFS-SKPHKIRPCQAKSNDIDTTFFD-QVDPEGDIT 88 Query: 94 FXXXXXXXXXXXXPSFDDLPPESEDEIAAAY 2 F P+FD+ P E+EDEIAAAY Sbjct: 89 FEPIEPPEGYVPPPAFDEGPSETEDEIAAAY 119