BLASTX nr result
ID: Papaver30_contig00005951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00005951 (454 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004248232.1| PREDICTED: probable rhamnose biosynthetic en... 79 2e-12 gb|KHN36936.1| Putative rhamnose biosynthetic enzyme 1 [Glycine ... 78 3e-12 ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic en... 78 3e-12 gb|KNA17871.1| hypothetical protein SOVF_075990 [Spinacia oleracea] 77 4e-12 ref|XP_009783771.1| PREDICTED: probable rhamnose biosynthetic en... 77 7e-12 ref|XP_009610279.1| PREDICTED: probable rhamnose biosynthetic en... 77 7e-12 ref|XP_008451740.1| PREDICTED: probable rhamnose biosynthetic en... 77 7e-12 ref|XP_004488984.1| PREDICTED: trifunctional UDP-glucose 4,6-deh... 77 7e-12 ref|XP_004303854.1| PREDICTED: trifunctional UDP-glucose 4,6-deh... 77 7e-12 ref|XP_004294169.1| PREDICTED: trifunctional UDP-glucose 4,6-deh... 77 7e-12 ref|XP_004137224.1| PREDICTED: trifunctional UDP-glucose 4,6-deh... 77 7e-12 ref|XP_012459028.1| PREDICTED: trifunctional UDP-glucose 4,6-deh... 76 1e-11 gb|KHN19477.1| Putative rhamnose biosynthetic enzyme 1 [Glycine ... 76 1e-11 gb|ADB24774.1| rhamnose synthase [Gossypium hirsutum] 76 1e-11 ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic en... 76 1e-11 gb|KMZ65370.1| dTDP-4-dehydrorhamnose reductase [Zostera marina] 75 1e-11 ref|XP_010035897.1| PREDICTED: probable rhamnose biosynthetic en... 75 1e-11 gb|KDO49287.1| hypothetical protein CISIN_1g005941mg [Citrus sin... 75 2e-11 emb|CBI20105.3| unnamed protein product [Vitis vinifera] 75 2e-11 ref|XP_006477818.1| PREDICTED: probable rhamnose biosynthetic en... 75 2e-11 >ref|XP_004248232.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum] gi|723734399|ref|XP_010327108.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum] Length = 674 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTSA 329 IVAARSNNEMDASKLK +FPELLSIK+SLIKYVFEPNKKTSA Sbjct: 633 IVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 674 >gb|KHN36936.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja] Length = 669 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTS 332 I+AARSNNEMDASKLKN+FPELLSIK+SLIKYVFEPNKKT+ Sbjct: 629 IIAARSNNEMDASKLKNEFPELLSIKESLIKYVFEPNKKTA 669 >ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X1 [Glycine max] gi|571500835|ref|XP_006594709.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X2 [Glycine max] gi|947072976|gb|KRH21867.1| hypothetical protein GLYMA_13G264500 [Glycine max] Length = 669 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTS 332 I+AARSNNEMDASKLKN+FPELLSIK+SLIKYVFEPNKKT+ Sbjct: 629 IIAARSNNEMDASKLKNEFPELLSIKESLIKYVFEPNKKTA 669 >gb|KNA17871.1| hypothetical protein SOVF_075990 [Spinacia oleracea] Length = 675 Score = 77.4 bits (189), Expect = 4e-12 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTS 332 IVAARSNNEMDASKLK +FPELLSIKDSLIKYVFEPNKKT+ Sbjct: 632 IVAARSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNKKTN 672 >ref|XP_009783771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana sylvestris] Length = 674 Score = 76.6 bits (187), Expect = 7e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTSA 329 IVAARSNNEMDASKLK +FPELL IK+SLIKYVFEPNKKTSA Sbjct: 633 IVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPNKKTSA 674 >ref|XP_009610279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana tomentosiformis] Length = 674 Score = 76.6 bits (187), Expect = 7e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTSA 329 IVAARSNNEMDASKLK +FPELL IK+SLIKYVFEPNKKTSA Sbjct: 633 IVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPNKKTSA 674 >ref|XP_008451740.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo] gi|659101691|ref|XP_008451741.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo] gi|659101693|ref|XP_008451742.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo] Length = 670 Score = 76.6 bits (187), Expect = 7e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTSA 329 IVA RSNNEMDASKLKN+FPE+L IK+SLIKYVFEPNKKTSA Sbjct: 629 IVAPRSNNEMDASKLKNEFPEMLGIKESLIKYVFEPNKKTSA 670 >ref|XP_004488984.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 [Cicer arietinum] gi|502089679|ref|XP_004488985.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 [Cicer arietinum] Length = 670 Score = 76.6 bits (187), Expect = 7e-12 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTS 332 IVAARSNNEMDASKLKN+FPELLSIK+SLIKYVFEPNKK++ Sbjct: 630 IVAARSNNEMDASKLKNEFPELLSIKESLIKYVFEPNKKSA 670 >ref|XP_004303854.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1-like [Fragaria vesca subsp. vesca] Length = 679 Score = 76.6 bits (187), Expect = 7e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTSA 329 IVA RSNNEMDASKLK +FPELLSIK+SLIKYVFEPNKKTSA Sbjct: 633 IVAPRSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 674 >ref|XP_004294169.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 [Fragaria vesca subsp. vesca] gi|764557842|ref|XP_011460833.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 [Fragaria vesca subsp. vesca] Length = 671 Score = 76.6 bits (187), Expect = 7e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTSA 329 IVAARSNNEMDASKLK +FPELL IK+SLIKYVFEPNKKTSA Sbjct: 629 IVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPNKKTSA 670 >ref|XP_004137224.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 [Cucumis sativus] gi|778691526|ref|XP_011653293.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 [Cucumis sativus] gi|700198418|gb|KGN53576.1| hypothetical protein Csa_4G083510 [Cucumis sativus] Length = 670 Score = 76.6 bits (187), Expect = 7e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTSA 329 IVA RSNNEMDASKLKN+FPE+L IK+SLIKYVFEPNKKTSA Sbjct: 629 IVAPRSNNEMDASKLKNEFPEMLGIKESLIKYVFEPNKKTSA 670 >ref|XP_012459028.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1-like [Gossypium raimondii] gi|763808543|gb|KJB75445.1| hypothetical protein B456_012G042300 [Gossypium raimondii] Length = 681 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTSA 329 IVA RSNNE+DASKLKN+FPELLSIKDSLIKYVFEPN+KT A Sbjct: 635 IVAPRSNNELDASKLKNEFPELLSIKDSLIKYVFEPNRKTFA 676 >gb|KHN19477.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja] Length = 669 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTS 332 I+A RSNNEMDASKLKN+FPELLSIK+SLIKYVFEPNKKT+ Sbjct: 629 IIAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNKKTA 669 >gb|ADB24774.1| rhamnose synthase [Gossypium hirsutum] Length = 681 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTSA 329 IVA RSNNE+DASKLKN+FPELLSIKDSLIKYVFEPN+KT A Sbjct: 635 IVAPRSNNELDASKLKNEFPELLSIKDSLIKYVFEPNRKTIA 676 >ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X1 [Glycine max] gi|571494814|ref|XP_006592951.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X2 [Glycine max] gi|947078588|gb|KRH27428.1| hypothetical protein GLYMA_12G234300 [Glycine max] gi|947078589|gb|KRH27429.1| hypothetical protein GLYMA_12G234300 [Glycine max] Length = 669 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTS 332 I+A RSNNEMDASKLKN+FPELLSIK+SLIKYVFEPNKKT+ Sbjct: 629 IIAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNKKTA 669 >gb|KMZ65370.1| dTDP-4-dehydrorhamnose reductase [Zostera marina] Length = 300 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTSA 329 IVA RSNNE+DASKLKN+FPELLSIK+SLIKYVFEPNKKT++ Sbjct: 257 IVAPRSNNELDASKLKNEFPELLSIKESLIKYVFEPNKKTTS 298 >ref|XP_010035897.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus grandis] gi|629080956|gb|KCW47401.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis] Length = 674 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTS 332 IVA RSNNEMDASKLK +FPELLSIKDSLIKYVFEPNK+TS Sbjct: 632 IVAPRSNNEMDASKLKREFPELLSIKDSLIKYVFEPNKRTS 672 >gb|KDO49287.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis] gi|641830193|gb|KDO49288.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis] Length = 668 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKT 335 IVA RSNNEMDASKLK +FPELLSIKDSLIKYVFEPNKKT Sbjct: 629 IVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNKKT 668 >emb|CBI20105.3| unnamed protein product [Vitis vinifera] Length = 192 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKTSA 329 IVAARSNNEMDASKLKN+FPELL IKDSLIKYVFEPN+K+ A Sbjct: 150 IVAARSNNEMDASKLKNEFPELLPIKDSLIKYVFEPNQKSLA 191 >ref|XP_006477818.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X1 [Citrus sinensis] gi|568848012|ref|XP_006477819.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X2 [Citrus sinensis] Length = 668 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 454 IVAARSNNEMDASKLKNKFPELLSIKDSLIKYVFEPNKKT 335 IVA RSNNEMDASKLK +FPELLSIKDSLIKYVFEPNKKT Sbjct: 629 IVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNKKT 668