BLASTX nr result
ID: Papaver30_contig00004596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00004596 (665 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFU15867.1| collagen-like protein [Bacillus thuringiensis MC28] 64 8e-08 ref|XP_007583681.1| putative pheromone precursor protein 1 prote... 57 1e-05 >gb|AFU15867.1| collagen-like protein [Bacillus thuringiensis MC28] Length = 378 Score = 63.9 bits (154), Expect = 8e-08 Identities = 41/99 (41%), Positives = 51/99 (51%), Gaps = 6/99 (6%) Frame = -3 Query: 660 CLLCPTYLW*VALCQLCPICPTYLV*AAQVFLLFPAFPAYLV*-VAEVYLLCPTFPAYLV 484 CL+CP +C +CP+CP LV V L++PA P LV V V L+CP P V Sbjct: 135 CLVCP-------VCPVCPVCPVCLV--CPVCLVYPACPVCLVYPVCLVCLVCPVCPVCPV 185 Query: 483 *----VAQVCLLCPTCPAYLV*-MAQVCLLCPTCPAYLV 382 V VC +CP CP V + VC +CP CP Y V Sbjct: 186 CPVCPVCPVCPVCPVCPVCPVCPVCPVCPVCPVCPVYPV 224 >ref|XP_007583681.1| putative pheromone precursor protein 1 protein [Neofusicoccum parvum UCRNP2] gi|485923836|gb|EOD48838.1| putative pheromone precursor protein 1 protein [Neofusicoccum parvum UCRNP2] Length = 253 Score = 57.0 bits (136), Expect = 1e-05 Identities = 40/121 (33%), Positives = 51/121 (42%), Gaps = 26/121 (21%) Frame = -1 Query: 644 PTCGRWRFANFA--QYAQPT---WCRQHRFSCFSQR-SQPT-----WCRWRRFTCF-AQR 501 P CG WR N A + A+P WCR C +R ++P WCRW+ C A+R Sbjct: 101 PFCG-WR-GNCAVKREAEPEAEPWCRWKGQPCSKKREAEPLPIADPWCRWKGQPCSKAKR 158 Query: 500 SRPTWCRWRRFAC-------------FAQRARPTWCRWRRFACF-AQRARPTWCRWHNFA 363 WCRW+ C A+ WCRW+ C A+R WCRW Sbjct: 159 EAEPWCRWKGQPCSKLKRAADAVADAAAEPEPEAWCRWKGQPCSKAKREAEPWCRWKGQP 218 Query: 362 C 360 C Sbjct: 219 C 219