BLASTX nr result
ID: Papaver30_contig00004079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00004079 (512 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precu... 68 3e-09 gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum] 66 9e-09 ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplast... 66 9e-09 sp|Q9XQ94.1|GLNA2_MEDSA RecName: Full=Glutamine synthetase leaf ... 65 2e-08 emb|CAA29057.1| gluthamine synthetase [Pisum sativum] 65 2e-08 sp|P08281.2|GLNA2_PEA RecName: Full=Glutamine synthetase leaf is... 65 2e-08 ref|XP_013462707.1| glutamine synthetase domain protein [Medicag... 65 2e-08 gb|AAN84563.1| glutamine synthetase [Lotus japonicus] 65 2e-08 gb|AAO85218.1| glutamine synthetase PR2 mutant [Lotus japonicus] 65 2e-08 gb|AAO85217.1| glutamine synthetase PR1 mutant [Lotus japonicus] 65 2e-08 gb|AAL67439.1| glutamine synthetase precursor [Lotus japonicus] 65 2e-08 prf||1601519A Gln synthetase 65 3e-08 gb|AGV54414.1| glutamine synthetase [Phaseolus vulgaris] 65 3e-08 ref|XP_007147796.1| hypothetical protein PHAVU_006G155800g [Phas... 65 3e-08 ref|XP_013462703.1| glutamine synthetase domain protein [Medicag... 65 3e-08 ref|XP_010666333.1| PREDICTED: glutamine synthetase leaf isozyme... 64 3e-08 gb|AAF17703.1|AF031082_1 glutamine synthetase [Canavalia lineata] 64 3e-08 sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chlo... 64 3e-08 gb|KOM53484.1| hypothetical protein LR48_Vigan09g214300 [Vigna a... 64 4e-08 pir||S22527 glutamate-ammonia ligase (EC 6.3.1.2) - tobacco 64 4e-08 >gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precursor [Mesembryanthemum crystallinum] Length = 433 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVTGLLAE+TLLWEPTLEAEALAAQKI MKV Sbjct: 399 MDPYVVTGLLAETTLLWEPTLEAEALAAQKIAMKV 433 >gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum] Length = 432 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVTGLLAE+T+LWEPTLEAEALAAQKI +KV Sbjct: 398 MDPYVVTGLLAETTILWEPTLEAEALAAQKISLKV 432 >ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum] gi|723658887|ref|XP_010322793.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum] Length = 432 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVTGLLAE+T+LWEPTLEAEALAAQKI +KV Sbjct: 398 MDPYVVTGLLAETTILWEPTLEAEALAAQKISLKV 432 >sp|Q9XQ94.1|GLNA2_MEDSA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; Flags: Precursor gi|4731322|gb|AAD28443.1|AF124244_1 glutamine synthetase precursor [Medicago sativa] Length = 428 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAESTLLWEPTLEAEALAAQKI +KV Sbjct: 394 MDPYVVTALLAESTLLWEPTLEAEALAAQKIALKV 428 >emb|CAA29057.1| gluthamine synthetase [Pisum sativum] Length = 373 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAESTLLWEPTLEAEALAAQKI +KV Sbjct: 339 MDPYVVTALLAESTLLWEPTLEAEALAAQKIALKV 373 >sp|P08281.2|GLNA2_PEA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; Flags: Precursor gi|169059|gb|AAA33653.1| glutamine synthetase (chloroplast GS2) (EC 6.3.1.2) [Pisum sativum] Length = 430 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAESTLLWEPTLEAEALAAQKI +KV Sbjct: 396 MDPYVVTALLAESTLLWEPTLEAEALAAQKIALKV 430 >ref|XP_013462707.1| glutamine synthetase domain protein [Medicago truncatula] gi|28629470|gb|AAO37651.1| glutamine synthetase [Medicago truncatula] gi|657396892|gb|KEH36741.1| glutamine synthetase domain protein [Medicago truncatula] Length = 428 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAESTLLWEPTLEAEALAAQKI +KV Sbjct: 394 MDPYVVTALLAESTLLWEPTLEAEALAAQKIALKV 428 >gb|AAN84563.1| glutamine synthetase [Lotus japonicus] Length = 430 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAE+TLLWEPTLEAEALAAQKI++KV Sbjct: 396 MDPYVVTALLAETTLLWEPTLEAEALAAQKIQLKV 430 >gb|AAO85218.1| glutamine synthetase PR2 mutant [Lotus japonicus] Length = 430 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAE+TLLWEPTLEAEALAAQKI++KV Sbjct: 396 MDPYVVTALLAETTLLWEPTLEAEALAAQKIQLKV 430 >gb|AAO85217.1| glutamine synthetase PR1 mutant [Lotus japonicus] Length = 430 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAE+TLLWEPTLEAEALAAQKI++KV Sbjct: 396 MDPYVVTALLAETTLLWEPTLEAEALAAQKIQLKV 430 >gb|AAL67439.1| glutamine synthetase precursor [Lotus japonicus] Length = 430 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAE+TLLWEPTLEAEALAAQKI++KV Sbjct: 396 MDPYVVTALLAETTLLWEPTLEAEALAAQKIQLKV 430 >prf||1601519A Gln synthetase Length = 429 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAESTLLWEPTLEAEALAAQK+ +KV Sbjct: 395 MDPYVVTSLLAESTLLWEPTLEAEALAAQKLALKV 429 >gb|AGV54414.1| glutamine synthetase [Phaseolus vulgaris] Length = 429 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAESTLLWEPTLEAEALAAQK+ +KV Sbjct: 395 MDPYVVTSLLAESTLLWEPTLEAEALAAQKLALKV 429 >ref|XP_007147796.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris] gi|593694552|ref|XP_007147797.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris] gi|121353|sp|P15102.1|GLNA4_PHAVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; AltName: Full=Glutamate--ammonia ligase; AltName: Full=Isozyme delta; Flags: Precursor gi|21005|emb|CAA31234.1| unnamed protein product [Phaseolus vulgaris] gi|561021019|gb|ESW19790.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris] gi|561021020|gb|ESW19791.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris] Length = 429 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAESTLLWEPTLEAEALAAQK+ +KV Sbjct: 395 MDPYVVTSLLAESTLLWEPTLEAEALAAQKLALKV 429 >ref|XP_013462703.1| glutamine synthetase domain protein [Medicago truncatula] gi|304569562|gb|ADM45299.1| chloroplast GS2b-alpha precursor [Medicago truncatula] gi|304569564|gb|ADM45300.1| chloroplast GS2b-beta precursor [Medicago truncatula] gi|657396889|gb|KEH36738.1| glutamine synthetase domain protein [Medicago truncatula] Length = 428 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAESTLLWEPTLEAEALAAQK+ +KV Sbjct: 394 MDPYVVTALLAESTLLWEPTLEAEALAAQKLALKV 428 >ref|XP_010666333.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta vulgaris subsp. vulgaris] gi|731372394|ref|XP_010666334.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta vulgaris subsp. vulgaris] gi|12963877|gb|AAK07678.1| glutamine synthetase GS2 [Beta vulgaris] gi|171346264|gb|ACB45672.1| plastid glutamine synthetase [Beta vulgaris] gi|870842862|gb|KMS96170.1| hypothetical protein BVRB_001510 [Beta vulgaris subsp. vulgaris] Length = 431 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVTGLLAESTLLWEPTLEAEALAAQ++ + V Sbjct: 397 MDPYVVTGLLAESTLLWEPTLEAEALAAQRLSLNV 431 >gb|AAF17703.1|AF031082_1 glutamine synthetase [Canavalia lineata] Length = 430 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAE+TLLWEPTLEAEALAAQKI +KV Sbjct: 396 MDPYVVTSLLAETTLLWEPTLEAEALAAQKIALKV 430 >sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; Flags: Precursor gi|2454633|gb|AAB71693.1| glutamine synthetase [Daucus carota] Length = 432 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVTGLLAE+TLLWEPTLEAEALAAQK+ + V Sbjct: 398 MDPYVVTGLLAETTLLWEPTLEAEALAAQKLSLNV 432 >gb|KOM53484.1| hypothetical protein LR48_Vigan09g214300 [Vigna angularis] Length = 429 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVT LLAE+TLLWEPTLEAEALAAQK+ +KV Sbjct: 395 MDPYVVTSLLAETTLLWEPTLEAEALAAQKLSLKV 429 >pir||S22527 glutamate-ammonia ligase (EC 6.3.1.2) - tobacco Length = 432 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 512 MDPYVVTGLLAESTLLWEPTLEAEALAAQKIKMKV 408 MDPYVVTGLLA++T+LWEPTLEAEALAAQK+ +KV Sbjct: 398 MDPYVVTGLLAQTTILWEPTLEAEALAAQKLALKV 432