BLASTX nr result
ID: Papaver30_contig00003666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00003666 (924 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529819.1| acetolactate synthase, putative [Ricinus com... 58 1e-07 ref|XP_010242460.1| PREDICTED: acetolactate synthase small subun... 61 1e-06 ref|XP_012829379.1| PREDICTED: acetolactate synthase small subun... 56 2e-06 gb|EYU17620.1| hypothetical protein MIMGU_mgv1a005378mg [Erythra... 56 2e-06 ref|XP_006353111.1| PREDICTED: acetolactate synthase small subun... 56 2e-06 ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Caps... 60 2e-06 ref|XP_011047624.1| PREDICTED: acetolactate synthase small subun... 55 3e-06 ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Popu... 55 3e-06 ref|XP_011085048.1| PREDICTED: acetolactate synthase small subun... 55 3e-06 ref|XP_011005277.1| PREDICTED: acetolactate synthase small subun... 55 3e-06 gb|KNA15049.1| hypothetical protein SOVF_101660 [Spinacia oleracea] 60 3e-06 gb|EPS72034.1| hypothetical protein M569_02723, partial [Genlise... 55 3e-06 ref|XP_011014725.1| PREDICTED: acetolactate synthase small subun... 59 7e-06 ref|XP_011014719.1| PREDICTED: acetolactate synthase small subun... 59 7e-06 ref|XP_011014695.1| PREDICTED: acetolactate synthase small subun... 59 7e-06 ref|XP_002316167.1| hypothetical protein POPTR_0010s18560g [Popu... 59 7e-06 ref|XP_009625350.1| PREDICTED: acetolactate synthase small subun... 54 7e-06 ref|XP_004251994.1| PREDICTED: acetolactate synthase small subun... 54 7e-06 gb|KNA12063.1| hypothetical protein SOVF_129290 [Spinacia oleracea] 54 7e-06 ref|XP_009625351.1| PREDICTED: acetolactate synthase small subun... 54 7e-06 >ref|XP_002529819.1| acetolactate synthase, putative [Ricinus communis] gi|223530696|gb|EEF32568.1| acetolactate synthase, putative [Ricinus communis] Length = 493 Score = 58.2 bits (139), Expect(2) = 1e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 673 IQVVEDLSSEPQVERELMLVKLNANESNRAEVMWLV 566 + VEDLSSEPQVERELML+K+NA+ S RAE+MWLV Sbjct: 156 VMKVEDLSSEPQVERELMLIKVNADPSYRAEIMWLV 191 Score = 25.8 bits (55), Expect(2) = 1e-07 Identities = 14/19 (73%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -2 Query: 566 GIFRANIVDI-EDPLTVEV 513 GIFRA IVDI E LT+EV Sbjct: 192 GIFRAKIVDISEHSLTIEV 210 >ref|XP_010242460.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Nelumbo nucifera] Length = 482 Score = 61.2 bits (147), Expect = 1e-06 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 688 LGMLLIQVVEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 L ++ + VED+S EPQVERELMLVKLNA+ SNRAE+MWLV+ Sbjct: 141 LKLVNVLKVEDISKEPQVERELMLVKLNADPSNRAEIMWLVD 182 >ref|XP_012829379.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like [Erythranthe guttatus] Length = 488 Score = 55.8 bits (133), Expect(2) = 2e-06 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VED+S +PQVERELML+K+NA+ ++RAEVMWLV+ Sbjct: 154 VEDISQDPQVERELMLIKINADPNHRAEVMWLVD 187 Score = 24.3 bits (51), Expect(2) = 2e-06 Identities = 13/18 (72%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 563 IFRANIVDIED-PLTVEV 513 IFRA IVDI D LT+EV Sbjct: 188 IFRAKIVDISDHSLTIEV 205 >gb|EYU17620.1| hypothetical protein MIMGU_mgv1a005378mg [Erythranthe guttata] Length = 486 Score = 55.8 bits (133), Expect(2) = 2e-06 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VED+S +PQVERELML+K+NA+ ++RAEVMWLV+ Sbjct: 152 VEDISQDPQVERELMLIKINADPNHRAEVMWLVD 185 Score = 24.3 bits (51), Expect(2) = 2e-06 Identities = 13/18 (72%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 563 IFRANIVDIED-PLTVEV 513 IFRA IVDI D LT+EV Sbjct: 186 IFRAKIVDISDHSLTIEV 203 >ref|XP_006353111.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like [Solanum tuberosum] Length = 481 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VEDLS EPQVERELML+K+NA+ RAEVMWLV+ Sbjct: 147 VEDLSKEPQVERELMLIKINADPKYRAEVMWLVD 180 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 12/18 (66%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 563 IFRANIVDIED-PLTVEV 513 +FRA IVDI D LT+EV Sbjct: 181 VFRAKIVDISDHSLTIEV 198 >ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Capsella rubella] gi|482562801|gb|EOA26991.1| hypothetical protein CARUB_v10023086mg [Capsella rubella] Length = 492 Score = 60.1 bits (144), Expect = 2e-06 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 688 LGMLLIQVVEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 L ++ + VED+SSEPQVERELMLVK+NAN +RAE+MWLV+ Sbjct: 148 LKLVNVLKVEDISSEPQVERELMLVKVNANPESRAEIMWLVD 189 >ref|XP_011047624.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Populus euphratica] Length = 521 Score = 55.1 bits (131), Expect(2) = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLV 566 VEDLS+EPQVERELMLVK+N + +RAE+MWLV Sbjct: 187 VEDLSNEPQVERELMLVKVNTDPKDRAEIMWLV 219 Score = 24.6 bits (52), Expect(2) = 3e-06 Identities = 13/19 (68%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -2 Query: 566 GIFRANIVDI-EDPLTVEV 513 GIFRA IVDI E +T+EV Sbjct: 220 GIFRAKIVDISEHTVTIEV 238 >ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa] gi|550333837|gb|EEE90845.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa] Length = 490 Score = 55.1 bits (131), Expect(2) = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLV 566 VEDLS+EPQVERELMLVK+N + +RAE+MWLV Sbjct: 153 VEDLSNEPQVERELMLVKVNTDPKDRAEIMWLV 185 Score = 24.6 bits (52), Expect(2) = 3e-06 Identities = 13/19 (68%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -2 Query: 566 GIFRANIVDI-EDPLTVEV 513 GIFRA IVDI E +T+EV Sbjct: 186 GIFRAKIVDISEHTVTIEV 204 >ref|XP_011085048.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like [Sesamum indicum] Length = 476 Score = 55.5 bits (132), Expect(2) = 3e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VED+S EPQVERELML+K+NA+ RAEVMWLV+ Sbjct: 143 VEDISKEPQVERELMLIKINADPKYRAEVMWLVD 176 Score = 24.3 bits (51), Expect(2) = 3e-06 Identities = 13/18 (72%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 563 IFRANIVDIED-PLTVEV 513 IFRA IVDI D LT+EV Sbjct: 177 IFRAKIVDISDHSLTIEV 194 >ref|XP_011005277.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like, partial [Populus euphratica] Length = 475 Score = 55.1 bits (131), Expect(2) = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLV 566 VEDLS+EPQVERELMLVK+N + +RAE+MWLV Sbjct: 141 VEDLSNEPQVERELMLVKVNTDPKDRAEIMWLV 173 Score = 24.6 bits (52), Expect(2) = 3e-06 Identities = 13/19 (68%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -2 Query: 566 GIFRANIVDI-EDPLTVEV 513 GIFRA IVDI E +T+EV Sbjct: 174 GIFRAKIVDISEHTVTIEV 192 >gb|KNA15049.1| hypothetical protein SOVF_101660 [Spinacia oleracea] Length = 487 Score = 59.7 bits (143), Expect = 3e-06 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VED+S EPQVERELMLVK+ AN+SNRAE+MWLV+ Sbjct: 152 VEDISKEPQVERELMLVKVRANQSNRAELMWLVD 185 >gb|EPS72034.1| hypothetical protein M569_02723, partial [Genlisea aurea] Length = 408 Score = 55.5 bits (132), Expect(2) = 3e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VED+S EPQVERELML+K+NA+ + RAEVMWLV+ Sbjct: 72 VEDISREPQVERELMLIKINADPAYRAEVMWLVD 105 Score = 23.9 bits (50), Expect(2) = 3e-06 Identities = 13/18 (72%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 563 IFRANIVDIED-PLTVEV 513 IFRA IVDI D LT+EV Sbjct: 106 IFRAKIVDIADMSLTIEV 123 >ref|XP_011014725.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like isoform X4 [Populus euphratica] Length = 392 Score = 58.5 bits (140), Expect = 7e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VED+S +PQVERELML+KLNAN S RAE+MWLV+ Sbjct: 148 VEDISRDPQVERELMLIKLNANPSTRAEIMWLVD 181 >ref|XP_011014719.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like isoform X3 [Populus euphratica] Length = 446 Score = 58.5 bits (140), Expect = 7e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VED+S +PQVERELML+KLNAN S RAE+MWLV+ Sbjct: 148 VEDISRDPQVERELMLIKLNANPSTRAEIMWLVD 181 >ref|XP_011014695.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like isoform X1 [Populus euphratica] gi|743801454|ref|XP_011014703.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like isoform X1 [Populus euphratica] Length = 490 Score = 58.5 bits (140), Expect = 7e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VED+S +PQVERELML+KLNAN S RAE+MWLV+ Sbjct: 148 VEDISRDPQVERELMLIKLNANPSTRAEIMWLVD 181 >ref|XP_002316167.1| hypothetical protein POPTR_0010s18560g [Populus trichocarpa] gi|222865207|gb|EEF02338.1| hypothetical protein POPTR_0010s18560g [Populus trichocarpa] Length = 414 Score = 58.5 bits (140), Expect = 7e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VED+S +PQVERELML+KLNAN S RAE+MWLV+ Sbjct: 72 VEDISRDPQVERELMLIKLNANPSTRAEIMWLVD 105 >ref|XP_009625350.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like isoform X1 [Nicotiana tomentosiformis] Length = 483 Score = 54.3 bits (129), Expect(2) = 7e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VEDLS EPQVERELML+K++A+ RAEVMWLV+ Sbjct: 149 VEDLSKEPQVERELMLIKISADPKYRAEVMWLVD 182 Score = 23.9 bits (50), Expect(2) = 7e-06 Identities = 12/18 (66%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 563 IFRANIVDIED-PLTVEV 513 +FRA IVDI D LT+EV Sbjct: 183 VFRAKIVDISDHSLTIEV 200 >ref|XP_004251994.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic [Solanum lycopersicum] Length = 481 Score = 53.9 bits (128), Expect(2) = 7e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VEDLS EPQVERELML+K++A+ RAEVMWLV+ Sbjct: 147 VEDLSKEPQVERELMLIKISADPKFRAEVMWLVD 180 Score = 24.3 bits (51), Expect(2) = 7e-06 Identities = 13/18 (72%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 563 IFRANIVDIED-PLTVEV 513 IFRA IVDI D LT+EV Sbjct: 181 IFRAKIVDISDHSLTIEV 198 >gb|KNA12063.1| hypothetical protein SOVF_129290 [Spinacia oleracea] Length = 477 Score = 53.5 bits (127), Expect(2) = 7e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VEDLS EPQVERELMLVKLNA+ + AE+ WLV+ Sbjct: 142 VEDLSREPQVERELMLVKLNADANTHAEIKWLVD 175 Score = 24.6 bits (52), Expect(2) = 7e-06 Identities = 14/18 (77%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = -2 Query: 563 IFRANIVDI-EDPLTVEV 513 IFRA IVDI ED +TVEV Sbjct: 176 IFRARIVDISEDLVTVEV 193 >ref|XP_009625351.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like isoform X2 [Nicotiana tomentosiformis] Length = 454 Score = 54.3 bits (129), Expect(2) = 7e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 664 VEDLSSEPQVERELMLVKLNANESNRAEVMWLVE 563 VEDLS EPQVERELML+K++A+ RAEVMWLV+ Sbjct: 149 VEDLSKEPQVERELMLIKISADPKYRAEVMWLVD 182 Score = 23.9 bits (50), Expect(2) = 7e-06 Identities = 12/18 (66%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 563 IFRANIVDIED-PLTVEV 513 +FRA IVDI D LT+EV Sbjct: 183 VFRAKIVDISDHSLTIEV 200