BLASTX nr result
ID: Papaver30_contig00003595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00003595 (444 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG12016.1| putative glycerophosphoryl diester phosphodiester... 59 1e-06 ref|XP_012461355.1| PREDICTED: glycerophosphodiester phosphodies... 57 4e-06 ref|XP_007020653.1| PLC-like phosphodiesterase family protein, p... 57 4e-06 ref|XP_007020652.1| PLC-like phosphodiesterase family protein, p... 57 4e-06 gb|KHG08046.1| putative glycerophosphoryl diester phosphodiester... 57 7e-06 ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl dieste... 57 7e-06 emb|CDY36746.1| BnaA03g11400D [Brassica napus] 56 9e-06 >gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like protein [Gossypium arboreum] Length = 762 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 441 LLQLVTTQYLPPTEAPNPSFTVADVSEPPLPPVSKQTA 328 LLQLVTT YLPP EAP P T +DV EPPLPPV+K T+ Sbjct: 684 LLQLVTTDYLPPAEAPKPYLTESDVVEPPLPPVAKTTS 721 >ref|XP_012461355.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Gossypium raimondii] gi|763746360|gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii] Length = 762 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -1 Query: 441 LLQLVTTQYLPPTEAPNPSFTVADVSEPPLPPVSKQTAS 325 LL LVTT YLPP EAP P T +DV EPPLPPV+K T++ Sbjct: 684 LLSLVTTDYLPPAEAPKPYLTESDVVEPPLPPVAKTTST 722 >ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 [Theobroma cacao] gi|508720281|gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 [Theobroma cacao] Length = 758 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 441 LLQLVTTQYLPPTEAPNPSFTVADVSEPPLPPVSKQTASDA 319 LLQLVT +YLPP EAPNP T AD++E PLPPV+ +T + + Sbjct: 682 LLQLVTAEYLPPAEAPNPYLTEADIAESPLPPVAAKTPTSS 722 >ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 [Theobroma cacao] gi|508720280|gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 [Theobroma cacao] Length = 760 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 441 LLQLVTTQYLPPTEAPNPSFTVADVSEPPLPPVSKQTASDA 319 LLQLVT +YLPP EAPNP T AD++E PLPPV+ +T + + Sbjct: 684 LLQLVTAEYLPPAEAPNPYLTEADIAESPLPPVAAKTPTSS 724 >gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like protein [Gossypium arboreum] Length = 775 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 441 LLQLVTTQYLPPTEAPNPSFTVADVSEPPLPPVSKQTASDAN 316 L QL+T YLPP EAPNP T ADV+EPPLPPV+ + S ++ Sbjct: 699 LYQLITAPYLPPAEAPNPFLTEADVNEPPLPPVAAKAPSTSS 740 >ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 2 [Nicotiana sylvestris] Length = 752 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -1 Query: 441 LLQLVTTQYLPPTEAPNPSFTVADVSEPPLPPVSKQTASDAN 316 LL L+ Q+LPP EAPNP T +DV EPPLPPV+K S+AN Sbjct: 677 LLGLIAPQFLPPAEAPNPVLTESDVVEPPLPPVAKINPSNAN 718 >emb|CDY36746.1| BnaA03g11400D [Brassica napus] Length = 766 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 444 GLLQLVTTQYLPPTEAPNPSFTVADVSEPPLPPVS 340 GLL++V+ +LPP EAPNP FT ADV+EPPLPPV+ Sbjct: 689 GLLEIVSPTFLPPAEAPNPVFTDADVTEPPLPPVT 723