BLASTX nr result
ID: Papaver30_contig00002074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00002074 (527 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007132778.1| hypothetical protein PHAVU_011G124300g [Phas... 54 6e-10 ref|XP_003527419.1| PREDICTED: 26S proteasome non-ATPase regulat... 54 6e-10 ref|XP_010100966.1| 26S proteasome non-ATPase regulatory subunit... 51 8e-10 ref|XP_010035795.1| PREDICTED: 26S proteasome non-ATPase regulat... 51 8e-10 ref|XP_008806650.1| PREDICTED: 26S proteasome non-ATPase regulat... 52 8e-10 gb|KCW47256.1| hypothetical protein EUGRSUZ_K01053 [Eucalyptus g... 51 8e-10 ref|XP_003607505.1| 26S proteasome regulatory subunit S2 1B [Med... 52 1e-09 ref|XP_013456679.1| 26S proteasome regulatory subunit S2 1B [Med... 52 1e-09 gb|KHN08804.1| 26S proteasome non-ATPase regulatory subunit 2 1A... 53 1e-09 ref|XP_003539943.1| PREDICTED: 26S proteasome non-ATPase regulat... 53 1e-09 ref|XP_014494134.1| PREDICTED: 26S proteasome non-ATPase regulat... 53 1e-09 ref|XP_010274582.1| PREDICTED: 26S proteasome non-ATPase regulat... 51 2e-09 ref|XP_010274583.1| PREDICTED: 26S proteasome non-ATPase regulat... 51 2e-09 ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, puta... 52 2e-09 ref|XP_012088219.1| PREDICTED: 26S proteasome non-ATPase regulat... 51 2e-09 ref|XP_010274584.1| PREDICTED: 26S proteasome non-ATPase regulat... 51 2e-09 ref|XP_010274585.1| PREDICTED: 26S proteasome non-ATPase regulat... 51 2e-09 ref|XP_010918461.1| PREDICTED: 26S proteasome non-ATPase regulat... 51 2e-09 ref|XP_010933319.1| PREDICTED: 26S proteasome non-ATPase regulat... 51 2e-09 ref|XP_011627451.1| PREDICTED: 26S proteasome non-ATPase regulat... 51 2e-09 >ref|XP_007132778.1| hypothetical protein PHAVU_011G124300g [Phaseolus vulgaris] gi|561005778|gb|ESW04772.1| hypothetical protein PHAVU_011G124300g [Phaseolus vulgaris] Length = 885 Score = 54.3 bits (129), Expect(2) = 6e-10 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF*QWKIQS 394 +R+EIRTSTSSM+ V KPLKFL PHYGTL T+ + ++S Sbjct: 65 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKTYYETMVES 103 Score = 35.8 bits (81), Expect(2) = 6e-10 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ +S+LKK LAD LSVLALT S E Sbjct: 96 YYETMVESDLKKYLADILSVLALTMSAE 123 >ref|XP_003527419.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Glycine max] gi|734312984|gb|KHN01100.1| 26S proteasome non-ATPase regulatory subunit 2 1A [Glycine soja] gi|947107516|gb|KRH55899.1| hypothetical protein GLYMA_06G289400 [Glycine max] Length = 885 Score = 54.3 bits (129), Expect(2) = 6e-10 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF*QWKIQS 394 +R+EIRTSTSSM+ V KPLKFL PHYGTL T+ + ++S Sbjct: 65 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKTYYETMVES 103 Score = 35.8 bits (81), Expect(2) = 6e-10 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ +S+LKK LAD LSVLALT S E Sbjct: 96 YYETMVESDLKKYLADILSVLALTMSAE 123 >ref|XP_010100966.1| 26S proteasome non-ATPase regulatory subunit 2 1A [Morus notabilis] gi|587898035|gb|EXB86491.1| 26S proteasome non-ATPase regulatory subunit 2 1A [Morus notabilis] Length = 899 Score = 50.8 bits (120), Expect(2) = 8e-10 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 72 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 103 Score = 38.9 bits (89), Expect(2) = 8e-10 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ DSELKK LAD LSVLALT S E Sbjct: 103 YYETMADSELKKYLADILSVLALTMSAE 130 >ref|XP_010035795.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A [Eucalyptus grandis] gi|629080810|gb|KCW47255.1| hypothetical protein EUGRSUZ_K01053 [Eucalyptus grandis] Length = 889 Score = 50.8 bits (120), Expect(2) = 8e-10 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 68 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 99 Score = 38.9 bits (89), Expect(2) = 8e-10 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+EDS+LK+ LAD LSVLALT S E Sbjct: 99 YYETMEDSDLKRYLADILSVLALTMSAE 126 >ref|XP_008806650.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Phoenix dactylifera] Length = 882 Score = 51.6 bits (122), Expect(2) = 8e-10 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF*QWKIQS 394 +RKEIRT+TSSM+ V KPLKFL PHYGTL + + + S Sbjct: 70 MRKEIRTATSSMTSVPKPLKFLRPHYGTLKAYFETMLDS 108 Score = 38.1 bits (87), Expect(2) = 8e-10 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 YF T+ DS+LKK LAD LSVLALT S E Sbjct: 101 YFETMLDSDLKKYLADILSVLALTMSAE 128 >gb|KCW47256.1| hypothetical protein EUGRSUZ_K01053 [Eucalyptus grandis] Length = 769 Score = 50.8 bits (120), Expect(2) = 8e-10 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 68 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 99 Score = 38.9 bits (89), Expect(2) = 8e-10 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+EDS+LK+ LAD LSVLALT S E Sbjct: 99 YYETMEDSDLKRYLADILSVLALTMSAE 126 >ref|XP_003607505.1| 26S proteasome regulatory subunit S2 1B [Medicago truncatula] gi|355508560|gb|AES89702.1| 26S proteasome regulatory subunit S2 1B [Medicago truncatula] Length = 886 Score = 52.4 bits (124), Expect(2) = 1e-09 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF*QWKIQS 394 +R+EIRTSTSSM+ V KPLKFL PHYGTL + + ++S Sbjct: 66 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAYYETMVES 104 Score = 37.0 bits (84), Expect(2) = 1e-09 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ +SELKK LAD LSVLALT S E Sbjct: 97 YYETMVESELKKYLADILSVLALTMSAE 124 >ref|XP_013456679.1| 26S proteasome regulatory subunit S2 1B [Medicago truncatula] gi|657388874|gb|KEH30710.1| 26S proteasome regulatory subunit S2 1B [Medicago truncatula] Length = 767 Score = 52.4 bits (124), Expect(2) = 1e-09 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF*QWKIQS 394 +R+EIRTSTSSM+ V KPLKFL PHYGTL + + ++S Sbjct: 66 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAYYETMVES 104 Score = 37.0 bits (84), Expect(2) = 1e-09 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ +SELKK LAD LSVLALT S E Sbjct: 97 YYETMVESELKKYLADILSVLALTMSAE 124 >gb|KHN08804.1| 26S proteasome non-ATPase regulatory subunit 2 1A [Glycine soja] Length = 885 Score = 52.8 bits (125), Expect(2) = 1e-09 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL T+ Sbjct: 65 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKTY 96 Score = 36.2 bits (82), Expect(2) = 1e-09 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ +S+LKK LAD LSVLALT S E Sbjct: 96 YYETMAESDLKKYLADILSVLALTMSAE 123 >ref|XP_003539943.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Glycine max] gi|947076803|gb|KRH25643.1| hypothetical protein GLYMA_12G117600 [Glycine max] Length = 885 Score = 52.8 bits (125), Expect(2) = 1e-09 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL T+ Sbjct: 65 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKTY 96 Score = 36.2 bits (82), Expect(2) = 1e-09 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ +S+LKK LAD LSVLALT S E Sbjct: 96 YYETMAESDLKKYLADILSVLALTMSAE 123 >ref|XP_014494134.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Vigna radiata var. radiata] Length = 884 Score = 52.8 bits (125), Expect(2) = 1e-09 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL T+ Sbjct: 65 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKTY 96 Score = 36.2 bits (82), Expect(2) = 1e-09 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ +S+LKK LAD LSVLALT S E Sbjct: 96 YYETMAESDLKKYLADILSVLALTMSAE 123 >ref|XP_010274582.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A isoform X1 [Nelumbo nucifera] Length = 912 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 70 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 101 Score = 37.7 bits (86), Expect(2) = 2e-09 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ DS+LKK LAD LSVLALT S E Sbjct: 101 YYETMADSDLKKYLADILSVLALTMSAE 128 >ref|XP_010274583.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A isoform X2 [Nelumbo nucifera] Length = 911 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 70 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 101 Score = 37.7 bits (86), Expect(2) = 2e-09 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ DS+LKK LAD LSVLALT S E Sbjct: 101 YYETMADSDLKKYLADILSVLALTMSAE 128 >ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] gi|223542840|gb|EEF44376.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] Length = 895 Score = 52.0 bits (123), Expect(2) = 2e-09 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL F Sbjct: 74 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAF 105 Score = 36.6 bits (83), Expect(2) = 2e-09 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 ++ T+ DS+LKK LAD LSVLALT S E Sbjct: 105 FYETMTDSDLKKLLADILSVLALTMSAE 132 >ref|XP_012088219.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A [Jatropha curcas] gi|643709675|gb|KDP24084.1| hypothetical protein JCGZ_25741 [Jatropha curcas] Length = 893 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 72 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 103 Score = 37.7 bits (86), Expect(2) = 2e-09 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ DS+LKK LAD LSVLALT S E Sbjct: 103 YYETMADSDLKKYLADILSVLALTMSAE 130 >ref|XP_010274584.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A isoform X3 [Nelumbo nucifera] Length = 892 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 70 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 101 Score = 37.7 bits (86), Expect(2) = 2e-09 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ DS+LKK LAD LSVLALT S E Sbjct: 101 YYETMADSDLKKYLADILSVLALTMSAE 128 >ref|XP_010274585.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A isoform X4 [Nelumbo nucifera] Length = 891 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 70 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 101 Score = 37.7 bits (86), Expect(2) = 2e-09 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ DS+LKK LAD LSVLALT S E Sbjct: 101 YYETMADSDLKKYLADILSVLALTMSAE 128 >ref|XP_010918461.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Elaeis guineensis] Length = 890 Score = 51.2 bits (121), Expect(2) = 2e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +RKEIRT+TSSM+ V KPLKFL PHYGTL + Sbjct: 70 MRKEIRTATSSMTSVPKPLKFLRPHYGTLKAY 101 Score = 37.4 bits (85), Expect(2) = 2e-09 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 YF T+ +S+LKK LAD LSVLALT S E Sbjct: 101 YFETMPESDLKKYLADILSVLALTMSAE 128 >ref|XP_010933319.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Elaeis guineensis] Length = 489 Score = 51.2 bits (121), Expect(2) = 2e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +RKEIRT+TSSM+ V KPLKFL PHYGTL + Sbjct: 70 MRKEIRTATSSMTSVPKPLKFLRPHYGTLKAY 101 Score = 37.4 bits (85), Expect(2) = 2e-09 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 YF T+ +S+LKK LAD LSVLALT S E Sbjct: 101 YFDTLPESDLKKYLADVLSVLALTMSAE 128 >ref|XP_011627451.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A [Amborella trichopoda] Length = 892 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 510 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 415 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 68 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 99 Score = 37.4 bits (85), Expect(2) = 2e-09 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 421 YFLTVEDSELKKCLADTLSVLALTTSVE 338 Y+ T+ DS+LKK LAD LSVLALT VE Sbjct: 99 YYETMADSDLKKYLADILSVLALTMCVE 126