BLASTX nr result
ID: Papaver30_contig00001337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00001337 (672 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006304376.1| hypothetical protein CARUB_v10010869mg [Caps... 54 6e-06 >ref|XP_006304376.1| hypothetical protein CARUB_v10010869mg [Capsella rubella] gi|482573087|gb|EOA37274.1| hypothetical protein CARUB_v10010869mg [Capsella rubella] Length = 637 Score = 54.3 bits (129), Expect(2) = 6e-06 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 8/55 (14%) Frame = +2 Query: 173 KTLERRCDLAFYCTTRNEIEKYDAVSLVT--------GSTMACTSQAVDVLRKAN 313 K RCD+AF C ++NE+++ DAV+LV GS M CT++AVDV RKAN Sbjct: 494 KPWNERCDVAFPCASQNEVDQADAVNLVNAGCRLLVEGSNMPCTAEAVDVFRKAN 548 Score = 23.1 bits (48), Expect(2) = 6e-06 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 123 LNSRSVHHREVSHYEDAKPWNE 188 L S + ++E+ KPWNE Sbjct: 477 LRDYSKTYARAKYFENVKPWNE 498