BLASTX nr result
ID: Papaver29_contig00064188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00064188 (763 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010259704.1| PREDICTED: pentatricopeptide repeat-containi... 44 1e-05 >ref|XP_010259704.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nelumbo nucifera] Length = 505 Score = 43.5 bits (101), Expect(3) = 1e-05 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 10/67 (14%) Frame = -2 Query: 459 VSMIRLWRE-QPWN---------KELSSRNSPGCSSIEVNGIS*EFVGRDKSCLTALQIS 310 +S++ L+RE + W+ KE+ + SPGCS IEVNG EFV DKS LQ+ Sbjct: 428 LSLLSLYREAERWDDVENVKREMKEVGCKKSPGCSLIEVNGDCHEFVAGDKSHPCVLQVC 487 Query: 309 LQIDKSI 289 L + + + Sbjct: 488 LNLSQLV 494 Score = 28.5 bits (62), Expect(3) = 1e-05 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 553 QFMNNMSSETNVAMWGVLLN 494 QF+ +M E N A+WG LLN Sbjct: 379 QFIRDMPVEANAAIWGALLN 398 Score = 24.3 bits (51), Expect(3) = 1e-05 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 Query: 509 GCTFKHCVDHKNAEVGELA 453 G C HKN +VGELA Sbjct: 394 GALLNACKVHKNVDVGELA 412