BLASTX nr result
ID: Papaver29_contig00064168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00064168 (519 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB28393.1| hypothetical protein B456_005G045400 [Gossypium r... 75 2e-11 ref|XP_012481912.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthio... 75 2e-11 gb|KHG14794.1| 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygen... 75 2e-11 ref|XP_012069701.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthio... 75 2e-11 ref|XP_009769178.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthio... 74 4e-11 ref|XP_009587300.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthio... 74 4e-11 gb|KCW84154.1| hypothetical protein EUGRSUZ_B01017 [Eucalyptus g... 74 4e-11 gb|KDO74456.1| hypothetical protein CISIN_1g025302mg [Citrus sin... 74 6e-11 gb|KDO74455.1| hypothetical protein CISIN_1g025302mg [Citrus sin... 74 6e-11 gb|KDO74454.1| hypothetical protein CISIN_1g025302mg [Citrus sin... 74 6e-11 gb|KCW84147.1| hypothetical protein EUGRSUZ_B01011 [Eucalyptus g... 74 6e-11 ref|XP_010034456.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthio... 74 6e-11 ref|XP_002517071.1| acireductone dioxygenase, putative [Ricinus ... 74 6e-11 ref|XP_006489460.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthio... 74 6e-11 ref|XP_006420033.1| hypothetical protein CICLE_v10005931mg [Citr... 74 6e-11 ref|XP_006420032.1| hypothetical protein CICLE_v10005931mg [Citr... 74 6e-11 gb|AFU51538.1| acireductone dioxygenase [Capsicum annuum] 74 6e-11 emb|CAL49076.1| acireductone dioxygenase [Plantago major] 74 6e-11 gb|KMS98853.1| hypothetical protein BVRB_3g068320 [Beta vulgaris... 73 7e-11 ref|XP_010693775.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthio... 73 7e-11 >gb|KJB28393.1| hypothetical protein B456_005G045400 [Gossypium raimondii] Length = 223 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIRVWVKKGGMIVLPAG+YHRFTLD+DNYIK ++L++ Sbjct: 147 KWIRVWVKKGGMIVLPAGIYHRFTLDTDNYIKAMRLFV 184 >ref|XP_012481912.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 [Gossypium raimondii] gi|763761138|gb|KJB28392.1| hypothetical protein B456_005G045400 [Gossypium raimondii] Length = 200 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIRVWVKKGGMIVLPAG+YHRFTLD+DNYIK ++L++ Sbjct: 124 KWIRVWVKKGGMIVLPAGIYHRFTLDTDNYIKAMRLFV 161 >gb|KHG14794.1| 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 [Gossypium arboreum] Length = 199 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIRVWVKKGGMIVLPAG+YHRFTLD+DNYIK ++L++ Sbjct: 123 KWIRVWVKKGGMIVLPAGIYHRFTLDTDNYIKAMRLFV 160 >ref|XP_012069701.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 [Jatropha curcas] gi|643733283|gb|KDP40230.1| hypothetical protein JCGZ_02228 [Jatropha curcas] Length = 200 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 +WIRVWVKKGGMIVLPAG+YHRFTLDSDNYIK ++L++ Sbjct: 124 RWIRVWVKKGGMIVLPAGIYHRFTLDSDNYIKAMRLFV 161 >ref|XP_009769178.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 [Nicotiana sylvestris] Length = 200 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 514 WIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 WIRVWVKKGGMIVLPAG+YHRFTLDSDNYIK ++L++ Sbjct: 125 WIRVWVKKGGMIVLPAGIYHRFTLDSDNYIKAMRLFV 161 >ref|XP_009587300.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 {ECO:0000255|HAMAP-Rule:MF_03154} [Nicotiana tomentosiformis] Length = 200 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 514 WIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 WIRVWVKKGGMIVLPAG+YHRFTLDSDNYIK ++L++ Sbjct: 125 WIRVWVKKGGMIVLPAGIYHRFTLDSDNYIKAMRLFV 161 >gb|KCW84154.1| hypothetical protein EUGRSUZ_B01017 [Eucalyptus grandis] Length = 199 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 514 WIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLY 407 WIRVWVKKGGMIVLPAGMYHRFTLDS+NYIKV +Y Sbjct: 125 WIRVWVKKGGMIVLPAGMYHRFTLDSNNYIKVFTIY 160 >gb|KDO74456.1| hypothetical protein CISIN_1g025302mg [Citrus sinensis] Length = 196 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIR+WVKKGGMIVLPAG YHRFTLD+DNYIK ++L++ Sbjct: 120 KWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFV 157 >gb|KDO74455.1| hypothetical protein CISIN_1g025302mg [Citrus sinensis] Length = 199 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIR+WVKKGGMIVLPAG YHRFTLD+DNYIK ++L++ Sbjct: 123 KWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFV 160 >gb|KDO74454.1| hypothetical protein CISIN_1g025302mg [Citrus sinensis] Length = 255 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIR+WVKKGGMIVLPAG YHRFTLD+DNYIK ++L++ Sbjct: 123 KWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFV 160 >gb|KCW84147.1| hypothetical protein EUGRSUZ_B01011 [Eucalyptus grandis] Length = 183 Score = 73.6 bits (179), Expect = 6e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 514 WIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 WIRVWVKKGGMIVLPAGMYHRFTLDS+NYIK ++L++ Sbjct: 108 WIRVWVKKGGMIVLPAGMYHRFTLDSNNYIKAMRLFV 144 >ref|XP_010034456.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 [Eucalyptus grandis] gi|702260982|ref|XP_010034462.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 [Eucalyptus grandis] gi|629119656|gb|KCW84146.1| hypothetical protein EUGRSUZ_B01011 [Eucalyptus grandis] Length = 200 Score = 73.6 bits (179), Expect = 6e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 514 WIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 WIRVWVKKGGMIVLPAGMYHRFTLDS+NYIK ++L++ Sbjct: 125 WIRVWVKKGGMIVLPAGMYHRFTLDSNNYIKAMRLFV 161 >ref|XP_002517071.1| acireductone dioxygenase, putative [Ricinus communis] gi|223543706|gb|EEF45234.1| acireductone dioxygenase, putative [Ricinus communis] Length = 200 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 +WIRVWVKKGGMIVLPAG+YHRFTLD+DNYIK ++L++ Sbjct: 124 RWIRVWVKKGGMIVLPAGIYHRFTLDTDNYIKAMRLFV 161 >ref|XP_006489460.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2-like [Citrus sinensis] Length = 199 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIR+WVKKGGMIVLPAG YHRFTLD+DNYIK ++L++ Sbjct: 123 KWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFV 160 >ref|XP_006420033.1| hypothetical protein CICLE_v10005931mg [Citrus clementina] gi|557521906|gb|ESR33273.1| hypothetical protein CICLE_v10005931mg [Citrus clementina] Length = 150 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIR+WVKKGGMIVLPAG YHRFTLD+DNYIK ++L++ Sbjct: 74 KWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFV 111 >ref|XP_006420032.1| hypothetical protein CICLE_v10005931mg [Citrus clementina] gi|557521905|gb|ESR33272.1| hypothetical protein CICLE_v10005931mg [Citrus clementina] Length = 199 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIR+WVKKGGMIVLPAG YHRFTLD+DNYIK ++L++ Sbjct: 123 KWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFV 160 >gb|AFU51538.1| acireductone dioxygenase [Capsicum annuum] Length = 200 Score = 73.6 bits (179), Expect = 6e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIRVWVKKGGMIVLPAG+YHRFTLDS NYIK ++L++ Sbjct: 124 KWIRVWVKKGGMIVLPAGIYHRFTLDSSNYIKAMRLFV 161 >emb|CAL49076.1| acireductone dioxygenase [Plantago major] Length = 200 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 514 WIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 WIRVWVKKGGMI+LPAG+YHRFTLDSDNYIK ++L++ Sbjct: 125 WIRVWVKKGGMIILPAGIYHRFTLDSDNYIKAMRLFV 161 >gb|KMS98853.1| hypothetical protein BVRB_3g068320 [Beta vulgaris subsp. vulgaris] Length = 201 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIR+WVKKG MIVLPAG+YHRFTLDSDNYIK ++L++ Sbjct: 125 KWIRIWVKKGAMIVLPAGIYHRFTLDSDNYIKAMRLFV 162 >ref|XP_010693775.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2-like [Beta vulgaris subsp. vulgaris] Length = 229 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 517 KWIRVWVKKGGMIVLPAGMYHRFTLDSDNYIKVLQLYL 404 KWIR+WVKKG MIVLPAG+YHRFTLDSDNYIK ++L++ Sbjct: 153 KWIRIWVKKGAMIVLPAGIYHRFTLDSDNYIKAMRLFV 190