BLASTX nr result
ID: Papaver29_contig00063614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00063614 (423 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008230169.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 60 5e-07 ref|XP_011100320.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 58 2e-06 ref|XP_006464881.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 58 2e-06 ref|XP_007132594.1| hypothetical protein PHAVU_011G108100g [Phas... 58 2e-06 ref|XP_010245204.1| PREDICTED: LOW QUALITY PROTEIN: F-box/FBD/LR... 58 3e-06 emb|CDY39929.1| BnaA09g15110D [Brassica napus] 58 3e-06 ref|XP_008777997.1| PREDICTED: F-box/LRR-repeat protein 25-like ... 57 4e-06 ref|XP_012091495.1| PREDICTED: F-box protein At5g03100-like [Jat... 57 5e-06 ref|XP_010045961.1| PREDICTED: putative F-box/LRR-repeat protein... 57 7e-06 ref|XP_009113470.1| PREDICTED: putative F-box/LRR-repeat protein... 57 7e-06 gb|KDO74280.1| hypothetical protein CISIN_1g044337mg [Citrus sin... 57 7e-06 ref|XP_006452021.1| hypothetical protein CICLE_v10010670mg, part... 57 7e-06 gb|KOM50428.1| hypothetical protein LR48_Vigan08g125500 [Vigna a... 56 9e-06 ref|XP_010245201.1| PREDICTED: F-box/LRR-repeat protein At4g1410... 56 9e-06 ref|XP_010245199.1| PREDICTED: F-box/LRR-repeat protein At4g1410... 56 9e-06 ref|XP_010267730.1| PREDICTED: F-box protein At4g09920 [Nelumbo ... 56 9e-06 ref|XP_013447865.1| F-box/RNI/FBD-like domain protein [Medicago ... 56 9e-06 ref|XP_003623802.1| F-box/RNI/FBD-like domain protein [Medicago ... 56 9e-06 >ref|XP_008230169.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g03220 [Prunus mume] Length = 463 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = -3 Query: 211 KNMGVGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTFA 53 +N+G G+DR+S+L D + H + SFLP K V TS+L+KRW+YL F L F+ Sbjct: 18 RNIGGGRDRLSDLPDDIAHRLLSFLPTKSVARTSVLSKRWRYLWACFPILNFS 70 >ref|XP_011100320.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g03220 [Sesamum indicum] Length = 514 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 6/70 (8%) Frame = -3 Query: 193 KDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTF------ANGSRLLK 32 +DRIS+L D +LHH+F FLPIK + TS+L+KRWK L F L F +N S ++ Sbjct: 24 EDRISDLPDDILHHVFFFLPIKSIAQTSVLSKRWKNLWYSFPDLDFTTVNSLSNDSIVMS 83 Query: 31 LMIREQSRLF 2 +R+++R + Sbjct: 84 STVRKRARSY 93 >ref|XP_006464881.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g00315-like [Citrus sinensis] Length = 448 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = -3 Query: 217 RHKNMGVGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTF 56 R K DRIS LHDS+LHHI SFLP+K VV TS+++KRW+ L +L F Sbjct: 4 RQKQTKKDADRISPLHDSILHHILSFLPVKEVVQTSLVSKRWQELWKCLPYLRF 57 >ref|XP_007132594.1| hypothetical protein PHAVU_011G108100g [Phaseolus vulgaris] gi|561005594|gb|ESW04588.1| hypothetical protein PHAVU_011G108100g [Phaseolus vulgaris] Length = 510 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -3 Query: 190 DRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTF 56 DRIS+L D++LHH+ LPIKCV SIL+KRWK+L C F L F Sbjct: 24 DRISDLPDAVLHHMLFLLPIKCVAQMSILSKRWKHLWCTFPDLDF 68 >ref|XP_010245204.1| PREDICTED: LOW QUALITY PROTEIN: F-box/FBD/LRR-repeat protein At5g56420-like [Nelumbo nucifera] Length = 255 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/65 (46%), Positives = 39/65 (60%) Frame = -3 Query: 196 GKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTFANGSRLLKLMIRE 17 G+ R+S L D +LH I SFLPIK V TSIL+ RWKYL L +G +++E Sbjct: 15 GEARLSSLPDHILHRILSFLPIKDAVRTSILSTRWKYLWTFVTHLYLVDGLLFCDKIVKE 74 Query: 16 QSRLF 2 +SR F Sbjct: 75 KSRSF 79 >emb|CDY39929.1| BnaA09g15110D [Brassica napus] Length = 117 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/51 (49%), Positives = 36/51 (70%) Frame = -3 Query: 208 NMGVGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTF 56 N+ G D IS L D +LHHIFSF+P K + TS+L+KRW+++ C +L+F Sbjct: 21 NLFGGVDSISSLPDEMLHHIFSFVPTKVAITTSVLSKRWRHVWCKTPYLSF 71 >ref|XP_008777997.1| PREDICTED: F-box/LRR-repeat protein 25-like [Phoenix dactylifera] Length = 394 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 190 DRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL 83 DRISEL D +LHHI S+LP K VV TSIL+KRW+YL Sbjct: 4 DRISELPDPILHHILSYLPTKLVVKTSILSKRWRYL 39 >ref|XP_012091495.1| PREDICTED: F-box protein At5g03100-like [Jatropha curcas] gi|643703823|gb|KDP20887.1| hypothetical protein JCGZ_21358 [Jatropha curcas] Length = 505 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/69 (44%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = -3 Query: 250 QSTSDLSQRDYRHKNMGVGKDRISELHDSLLHHIFSFLP-IKCVVATSILAKRWKYL*CL 74 Q+ + R Y+ +DRIS LHDSL HHI SFLP + V+ TS+L+KRW+Y+ Sbjct: 21 QAIDFVEDRSYKRLKSPENEDRISALHDSLTHHILSFLPSTEDVIKTSVLSKRWQYIWTH 80 Query: 73 FLFLTFANG 47 LTF G Sbjct: 81 VPNLTFELG 89 >ref|XP_010045961.1| PREDICTED: putative F-box/LRR-repeat protein At3g18150 [Eucalyptus grandis] Length = 490 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = -3 Query: 250 QSTSDLSQRDYRHKNMGVGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWK 89 +ST D R R + D IS L D+++HHIFSFLP+K VV TS+L+KRW+ Sbjct: 13 RSTGDRPNRHKRRRPPPPSSDLISALPDAVIHHIFSFLPLKDVVKTSVLSKRWR 66 >ref|XP_009113470.1| PREDICTED: putative F-box/LRR-repeat protein At5g02930 [Brassica rapa] Length = 457 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/51 (50%), Positives = 35/51 (68%) Frame = -3 Query: 208 NMGVGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTF 56 N+ G D IS L D +LHHIFSF+P K TS+L+KRW++L C +L+F Sbjct: 21 NLFGGVDSISSLPDEMLHHIFSFVPTKVANTTSVLSKRWRHLWCKTPYLSF 71 >gb|KDO74280.1| hypothetical protein CISIN_1g044337mg [Citrus sinensis] Length = 428 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 190 DRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL 83 DRIS LHDS+LHHI SFLP+K VV TS+++KRW+ L Sbjct: 14 DRISPLHDSILHHILSFLPVKEVVQTSLVSKRWQEL 49 >ref|XP_006452021.1| hypothetical protein CICLE_v10010670mg, partial [Citrus clementina] gi|557555247|gb|ESR65261.1| hypothetical protein CICLE_v10010670mg, partial [Citrus clementina] Length = 182 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 190 DRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL 83 DRIS LHDS+LHHI SFLP+K VV TS+++KRW+ L Sbjct: 14 DRISPLHDSILHHILSFLPVKEVVQTSLVSKRWQEL 49 >gb|KOM50428.1| hypothetical protein LR48_Vigan08g125500 [Vigna angularis] Length = 510 Score = 56.2 bits (134), Expect = 9e-06 Identities = 32/70 (45%), Positives = 41/70 (58%), Gaps = 6/70 (8%) Frame = -3 Query: 199 VGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTFAN------GSRL 38 V DRIS+L D++LH I LPIKCV SIL+KRW++L C F L F S+ Sbjct: 21 VTTDRISDLPDAVLHQILFLLPIKCVAQMSILSKRWRHLWCTFPDLDFRTLDQFQISSKY 80 Query: 37 LKLMIREQSR 8 LK + E+ R Sbjct: 81 LKFLEFEKPR 90 >ref|XP_010245201.1| PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X2 [Nelumbo nucifera] Length = 470 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/65 (46%), Positives = 38/65 (58%) Frame = -3 Query: 196 GKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTFANGSRLLKLMIRE 17 G+ R+S L D +LH I SFLPIK V TSIL+ RWKYL L +G ++E Sbjct: 15 GEARLSSLPDHILHRILSFLPIKDAVRTSILSTRWKYLWTFITHLYLDDGLLFCDKNVKE 74 Query: 16 QSRLF 2 +SR F Sbjct: 75 KSRRF 79 >ref|XP_010245199.1| PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X1 [Nelumbo nucifera] gi|720090745|ref|XP_010245200.1| PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X1 [Nelumbo nucifera] Length = 500 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/65 (46%), Positives = 38/65 (58%) Frame = -3 Query: 196 GKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTFANGSRLLKLMIRE 17 G+ R+S L D +LH I SFLPIK V TSIL+ RWKYL L +G ++E Sbjct: 15 GEARLSSLPDHILHRILSFLPIKDAVRTSILSTRWKYLWTFITHLYLDDGLLFCDKNVKE 74 Query: 16 QSRLF 2 +SR F Sbjct: 75 KSRRF 79 >ref|XP_010267730.1| PREDICTED: F-box protein At4g09920 [Nelumbo nucifera] Length = 451 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 190 DRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL 83 DRISEL DS++ HI SFLP+K V+ TS L+KRWKYL Sbjct: 12 DRISELPDSVIQHILSFLPVKDVIRTSFLSKRWKYL 47 >ref|XP_013447865.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] gi|657376927|gb|KEH21892.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 396 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -3 Query: 208 NMGVGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL 83 N+G GKD IS+LH +LH+I S LP K V+ TS+LA +W+YL Sbjct: 14 NVGDGKDMISDLHGDILHYILSLLPTKDVIRTSVLATKWRYL 55 >ref|XP_003623802.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] gi|355498817|gb|AES80020.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 394 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = -3 Query: 205 MGVGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTFAN 50 M +DRIS+L D ++HHI S++P K V TS+L+KRW L C FL F++ Sbjct: 1 MAPSEDRISKLDDKIIHHILSYVPTKDAVTTSVLSKRWTNLWCFVPFLDFSD 52