BLASTX nr result
ID: Papaver29_contig00063491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00063491 (406 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009801349.1| PREDICTED: uncharacterized protein LOC104247... 57 4e-06 >ref|XP_009801349.1| PREDICTED: uncharacterized protein LOC104247099 isoform X1 [Nicotiana sylvestris] Length = 262 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/39 (74%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -3 Query: 197 CD*GFVMGV--ISKTEVNLRRLLATAPQQKNQAKLIHYV 87 C GF+ GV +SKTEVNL+RLL TAPQQ+NQAKLIHYV Sbjct: 16 CSYGFLEGVMGLSKTEVNLKRLLVTAPQQQNQAKLIHYV 54