BLASTX nr result
ID: Papaver29_contig00061422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00061422 (735 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009773611.1| PREDICTED: probable serine/threonine-protein... 63 2e-07 ref|XP_014510481.1| PREDICTED: probable serine/threonine-protein... 58 6e-06 gb|KQL13047.1| hypothetical protein SETIT_022429mg [Setaria ital... 58 6e-06 dbj|BAS92291.1| Os05g0149800 [Oryza sativa Japonica Group] 58 6e-06 gb|KOM33537.1| hypothetical protein LR48_Vigan01g309300 [Vigna a... 58 6e-06 gb|KNA18942.1| hypothetical protein SOVF_066090 [Spinacia oleracea] 58 6e-06 ref|XP_012700472.1| PREDICTED: probable serine/threonine-protein... 58 6e-06 ref|XP_012455317.1| PREDICTED: probable serine/threonine-protein... 58 6e-06 gb|KJB72614.1| hypothetical protein B456_011G187900 [Gossypium r... 58 6e-06 gb|KJB72613.1| hypothetical protein B456_011G187900 [Gossypium r... 58 6e-06 gb|KJB72612.1| hypothetical protein B456_011G187900 [Gossypium r... 58 6e-06 gb|KJB72611.1| hypothetical protein B456_011G187900 [Gossypium r... 58 6e-06 ref|XP_011005539.1| PREDICTED: probable serine/threonine-protein... 58 6e-06 ref|XP_010931600.1| PREDICTED: probable serine/threonine-protein... 58 6e-06 gb|KHN02992.1| Serine/threonine-protein phosphatase 2A regulator... 58 6e-06 ref|XP_010666391.1| PREDICTED: probable serine/threonine-protein... 58 6e-06 ref|XP_010231703.1| PREDICTED: probable serine/threonine-protein... 58 6e-06 ref|XP_010243557.1| PREDICTED: probable serine/threonine-protein... 58 6e-06 ref|XP_010261642.1| PREDICTED: probable serine/threonine-protein... 58 6e-06 ref|XP_009339840.1| PREDICTED: probable serine/threonine-protein... 58 6e-06 >ref|XP_009773611.1| PREDICTED: probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 [Nicotiana sylvestris] Length = 323 Score = 62.8 bits (151), Expect = 2e-07 Identities = 42/88 (47%), Positives = 47/88 (53%), Gaps = 3/88 (3%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQVVSY*KFGLLLCSCMLLPA---GSLGHNLYCLGY 564 PHRRGKACIKK+LLSNCLQELMELHQV S C +LL A G + YC Sbjct: 251 PHRRGKACIKKILLSNCLQELMELHQVTS-------SCRVLLLNAIKRGLSATDKYC--- 300 Query: 563 SFVLGVEVFTCIIYKSYTTFHLYKSFFL 480 + CI Y +F L FFL Sbjct: 301 -----ISSLKCIAI--YLSFVLVTVFFL 321 >ref|XP_014510481.1| PREDICTED: probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 [Vigna radiata var. radiata] Length = 476 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 249 PHRRGKACIKKVLLSNCLQELMELHQ 274 >gb|KQL13047.1| hypothetical protein SETIT_022429mg [Setaria italica] Length = 365 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 137 PHRRGKACIKKVLLSNCLQELMELHQ 162 >dbj|BAS92291.1| Os05g0149800 [Oryza sativa Japonica Group] Length = 346 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 118 PHRRGKACIKKVLLSNCLQELMELHQ 143 >gb|KOM33537.1| hypothetical protein LR48_Vigan01g309300 [Vigna angularis] Length = 490 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 263 PHRRGKACIKKVLLSNCLQELMELHQ 288 >gb|KNA18942.1| hypothetical protein SOVF_066090 [Spinacia oleracea] Length = 478 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 250 PHRRGKACIKKVLLSNCLQELMELHQ 275 >ref|XP_012700472.1| PREDICTED: probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 [Setaria italica] Length = 432 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 204 PHRRGKACIKKVLLSNCLQELMELHQ 229 >ref|XP_012455317.1| PREDICTED: probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 [Gossypium raimondii] gi|763805677|gb|KJB72615.1| hypothetical protein B456_011G187900 [Gossypium raimondii] Length = 478 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 250 PHRRGKACIKKVLLSNCLQELMELHQ 275 >gb|KJB72614.1| hypothetical protein B456_011G187900 [Gossypium raimondii] Length = 437 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 250 PHRRGKACIKKVLLSNCLQELMELHQ 275 >gb|KJB72613.1| hypothetical protein B456_011G187900 [Gossypium raimondii] Length = 399 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 250 PHRRGKACIKKVLLSNCLQELMELHQ 275 >gb|KJB72612.1| hypothetical protein B456_011G187900 [Gossypium raimondii] Length = 310 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 250 PHRRGKACIKKVLLSNCLQELMELHQ 275 >gb|KJB72611.1| hypothetical protein B456_011G187900 [Gossypium raimondii] Length = 284 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 56 PHRRGKACIKKVLLSNCLQELMELHQ 81 >ref|XP_011005539.1| PREDICTED: probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 [Populus euphratica] Length = 476 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 249 PHRRGKACIKKVLLSNCLQELMELHQ 274 >ref|XP_010931600.1| PREDICTED: probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 [Elaeis guineensis] Length = 477 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 250 PHRRGKACIKKVLLSNCLQELMELHQ 275 >gb|KHN02992.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma [Glycine soja] Length = 496 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 270 PHRRGKACIKKVLLSNCLQELMELHQ 295 >ref|XP_010666391.1| PREDICTED: probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 [Beta vulgaris subsp. vulgaris] gi|870842818|gb|KMS96140.1| hypothetical protein BVRB_001760 [Beta vulgaris subsp. vulgaris] Length = 478 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 250 PHRRGKACIKKVLLSNCLQELMELHQ 275 >ref|XP_010231703.1| PREDICTED: probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 isoform X1 [Brachypodium distachyon] Length = 496 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 258 PHRRGKACIKKVLLSNCLQELMELHQ 283 >ref|XP_010243557.1| PREDICTED: probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 [Nelumbo nucifera] Length = 476 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 249 PHRRGKACIKKVLLSNCLQELMELHQ 274 >ref|XP_010261642.1| PREDICTED: probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 [Nelumbo nucifera] Length = 405 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 194 PHRRGKACIKKVLLSNCLQELMELHQ 219 >ref|XP_009339840.1| PREDICTED: probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 [Pyrus x bretschneideri] Length = 476 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 734 PHRRGKACIKKVLLSNCLQELMELHQ 657 PHRRGKACIKKVLLSNCLQELMELHQ Sbjct: 249 PHRRGKACIKKVLLSNCLQELMELHQ 274