BLASTX nr result
ID: Papaver29_contig00061350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00061350 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356287.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 ref|XP_010320034.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_010320030.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_012854326.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_010262348.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-14 ref|XP_010519391.1| PREDICTED: pentatricopeptide repeat-containi... 83 7e-14 ref|XP_010519389.1| PREDICTED: pentatricopeptide repeat-containi... 83 7e-14 ref|XP_009798649.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-13 ref|XP_009600041.1| PREDICTED: pentatricopeptide repeat-containi... 80 5e-13 ref|XP_011081305.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_010679916.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_002278218.1| PREDICTED: pentatricopeptide repeat-containi... 77 7e-12 ref|XP_011659131.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_008237679.1| PREDICTED: pentatricopeptide repeat-containi... 74 6e-11 ref|XP_008466537.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 gb|ADN34182.1| pentatricopeptide repeat-containing protein [Cucu... 73 7e-11 ref|XP_006299083.1| hypothetical protein CARUB_v10015238mg [Caps... 72 1e-10 ref|XP_002884708.1| pentatricopeptide repeat-containing protein ... 72 1e-10 ref|XP_006407716.1| hypothetical protein EUTSA_v10019974mg [Eutr... 72 2e-10 ref|XP_013623657.1| PREDICTED: pentatricopeptide repeat-containi... 70 5e-10 >ref|XP_006356287.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565379764|ref|XP_006356288.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565379766|ref|XP_006356289.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like isoform X3 [Solanum tuberosum] gi|565379768|ref|XP_006356290.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like isoform X4 [Solanum tuberosum] gi|565379770|ref|XP_006356291.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like isoform X5 [Solanum tuberosum] Length = 1028 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/66 (57%), Positives = 48/66 (72%) Frame = -2 Query: 199 YSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGKLGNIIVDL 20 Y+NLL C+QECK +QSR V D+MP ++A K CK IH ++L LG+ QG LGN IVDL Sbjct: 46 YNNLLKICLQECKNLQSRRVFDEMPQRAARAVKACKTIHLQSLKLGFASQGHLGNSIVDL 105 Query: 19 YGKCGE 2 Y KCG+ Sbjct: 106 YAKCGD 111 >ref|XP_010320034.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial isoform X2 [Solanum lycopersicum] Length = 996 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/66 (57%), Positives = 47/66 (71%) Frame = -2 Query: 199 YSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGKLGNIIVDL 20 Y NLL C+QECK +QSR V D+MP ++A K CK IH ++L LG+ QG LGN IVDL Sbjct: 46 YDNLLKICLQECKNLQSRRVFDEMPQRVARAVKACKTIHLQSLKLGFASQGHLGNSIVDL 105 Query: 19 YGKCGE 2 Y KCG+ Sbjct: 106 YAKCGD 111 >ref|XP_010320030.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial isoform X1 [Solanum lycopersicum] gi|723693582|ref|XP_010320031.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial isoform X1 [Solanum lycopersicum] gi|723693585|ref|XP_010320032.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial isoform X1 [Solanum lycopersicum] gi|723693588|ref|XP_010320033.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial isoform X1 [Solanum lycopersicum] Length = 1021 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/66 (57%), Positives = 47/66 (71%) Frame = -2 Query: 199 YSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGKLGNIIVDL 20 Y NLL C+QECK +QSR V D+MP ++A K CK IH ++L LG+ QG LGN IVDL Sbjct: 46 YDNLLKICLQECKNLQSRRVFDEMPQRVARAVKACKTIHLQSLKLGFASQGHLGNSIVDL 105 Query: 19 YGKCGE 2 Y KCG+ Sbjct: 106 YAKCGD 111 >ref|XP_012854326.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Erythranthe guttatus] Length = 985 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = -2 Query: 205 YTYSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGKLGNIIV 26 Y Y+NLL C+QECK+IQSR V D+MPH S + K K IH + L+ G GKLGN I+ Sbjct: 45 YFYNNLLKICLQECKKIQSRQVLDRMPHRHSASLKTAKAIHTRVLTFGISKDGKLGNSIL 104 Query: 25 DLYGKCG 5 DLY KCG Sbjct: 105 DLYAKCG 111 >ref|XP_010262348.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Nelumbo nucifera] Length = 1027 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/85 (44%), Positives = 61/85 (71%), Gaps = 1/85 (1%) Frame = -2 Query: 253 AVEEVQQNFQL-VPNQNYTYSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAK 77 A +E+ + Q+ + +++ Y++LL C+QECK +QS + PHL++Q+ +K K IHA+ Sbjct: 29 ATKEINRKIQVELTPEHHIYNDLLKACLQECKLVQSH---GETPHLQAQSLRKSKTIHAQ 85 Query: 76 TLSLGYGLQGKLGNIIVDLYGKCGE 2 L +G+GL+GKLGN +VDLY KCG+ Sbjct: 86 VLKIGFGLKGKLGNFLVDLYSKCGD 110 >ref|XP_010519391.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial isoform X2 [Tarenaya hassleriana] Length = 968 Score = 83.2 bits (204), Expect = 7e-14 Identities = 35/74 (47%), Positives = 53/74 (71%) Frame = -2 Query: 223 LVPNQNYTYSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGK 44 ++P Q++ Y LL C+++C +++SR V D+MPH QA + K +HA++L LG+G +G Sbjct: 40 VLPRQDHVYGRLLENCLKQCGKVKSRKVFDEMPHRLEQALRTGKAVHAQSLILGFGSKGM 99 Query: 43 LGNIIVDLYGKCGE 2 LGN I+DLY KCGE Sbjct: 100 LGNAILDLYAKCGE 113 >ref|XP_010519389.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial isoform X1 [Tarenaya hassleriana] gi|729430401|ref|XP_010519390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial isoform X1 [Tarenaya hassleriana] Length = 1033 Score = 83.2 bits (204), Expect = 7e-14 Identities = 35/74 (47%), Positives = 53/74 (71%) Frame = -2 Query: 223 LVPNQNYTYSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGK 44 ++P Q++ Y LL C+++C +++SR V D+MPH QA + K +HA++L LG+G +G Sbjct: 40 VLPRQDHVYGRLLENCLKQCGKVKSRKVFDEMPHRLEQALRTGKAVHAQSLILGFGSKGM 99 Query: 43 LGNIIVDLYGKCGE 2 LGN I+DLY KCGE Sbjct: 100 LGNAILDLYAKCGE 113 >ref|XP_009798649.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Nicotiana sylvestris] Length = 1037 Score = 81.3 bits (199), Expect = 3e-13 Identities = 37/66 (56%), Positives = 46/66 (69%) Frame = -2 Query: 199 YSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGKLGNIIVDL 20 Y+NLL C QECK++QSRHV D+ P + A+K CK IH ++L G QG LGN IVDL Sbjct: 46 YNNLLKICHQECKKLQSRHVFDEFPQKAACASKACKTIHVQSLKHGIASQGHLGNAIVDL 105 Query: 19 YGKCGE 2 Y KCG+ Sbjct: 106 YAKCGD 111 >ref|XP_009600041.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Nicotiana tomentosiformis] Length = 1037 Score = 80.5 bits (197), Expect = 5e-13 Identities = 35/66 (53%), Positives = 48/66 (72%) Frame = -2 Query: 199 YSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGKLGNIIVDL 20 Y+NLL C QECK++QSRH+ D++P ++A+K CK IH ++L G +G LGN IVDL Sbjct: 46 YNNLLKICQQECKKLQSRHLFDELPQKAARASKACKSIHVQSLKHGIASKGHLGNAIVDL 105 Query: 19 YGKCGE 2 Y KCG+ Sbjct: 106 YAKCGD 111 >ref|XP_011081305.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Sesamum indicum] Length = 985 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/66 (54%), Positives = 46/66 (69%) Frame = -2 Query: 199 YSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGKLGNIIVDL 20 YS+LL C+QECK+IQSR + D+MP S + K K +HA++L LG G LGN IVDL Sbjct: 47 YSHLLKICLQECKKIQSRQLLDRMPERLSLSVKTAKTVHARSLKLGVSSDGDLGNSIVDL 106 Query: 19 YGKCGE 2 Y KCG+ Sbjct: 107 YAKCGQ 112 >ref|XP_010679916.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Beta vulgaris subsp. vulgaris] gi|731313366|ref|XP_010679925.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Beta vulgaris subsp. vulgaris] gi|731313368|ref|XP_010679932.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Beta vulgaris subsp. vulgaris] gi|731313370|ref|XP_010679940.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Beta vulgaris subsp. vulgaris] gi|731313372|ref|XP_010679947.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Beta vulgaris subsp. vulgaris] gi|731313374|ref|XP_010679956.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Beta vulgaris subsp. vulgaris] gi|731313376|ref|XP_010679964.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Beta vulgaris subsp. vulgaris] gi|731313378|ref|XP_010679971.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Beta vulgaris subsp. vulgaris] Length = 1012 Score = 78.2 bits (191), Expect = 2e-12 Identities = 32/66 (48%), Positives = 49/66 (74%) Frame = -2 Query: 202 TYSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGKLGNIIVD 23 TY +LL C+++C +I++R + ++MP SQA+ CK IHA++L G+GL G+LGN ++D Sbjct: 68 TYDHLLKLCLEQCGKIKARQLFEEMPQRISQASYACKAIHARSLKFGFGLNGQLGNAVLD 127 Query: 22 LYGKCG 5 LY KCG Sbjct: 128 LYAKCG 133 >ref|XP_002278218.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Vitis vinifera] gi|302142763|emb|CBI19966.3| unnamed protein product [Vitis vinifera] Length = 1048 Score = 76.6 bits (187), Expect = 7e-12 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 6/84 (7%) Frame = -2 Query: 238 QQNFQLVPNQ-NYT-----YSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAK 77 Q NF + Q N T +++LL C+Q+C+RI+ RH D+ P +QA++ K IHA+ Sbjct: 47 QSNFSTIQRQVNQTSEHKIFTHLLKICLQQCQRIKIRHPFDETPQRLAQASRTSKTIHAQ 106 Query: 76 TLSLGYGLQGKLGNIIVDLYGKCG 5 TL G+G +G+LG+ IVDLY KCG Sbjct: 107 TLKFGFGSKGRLGSAIVDLYAKCG 130 >ref|XP_011659131.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Cucumis sativus] gi|778726623|ref|XP_011659132.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Cucumis sativus] gi|700189268|gb|KGN44501.1| hypothetical protein Csa_7G320000 [Cucumis sativus] Length = 994 Score = 75.1 bits (183), Expect = 2e-11 Identities = 39/76 (51%), Positives = 50/76 (65%) Frame = -2 Query: 232 NFQLVPNQNYTYSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGL 53 N QLV N N +S L C+Q C RIQ+ ++ D+ P QA KVIH+K+L +G GL Sbjct: 36 NQQLVKNLN-PHSEFLQICLQHCWRIQAHNLFDEKPKPVLQALSTAKVIHSKSLKIGVGL 94 Query: 52 QGKLGNIIVDLYGKCG 5 +G LGN+IVDLY KCG Sbjct: 95 KGLLGNVIVDLYVKCG 110 >ref|XP_008237679.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Prunus mume] Length = 1020 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = -2 Query: 199 YSNLLYTCVQECKRIQSRHVCDKMPH-LKSQATKKCKVIHAKTLSLGYGLQGKLGNIIVD 23 Y+NLL C+Q+CK I++ V D+MP L +QA++ CK IHA++L G G +G LGN IV Sbjct: 37 YTNLLQICIQQCKNIKTHKVFDEMPERLLAQASRTCKTIHAQSLKFGVGSKGFLGNAIVG 96 Query: 22 LYGKCG 5 Y KCG Sbjct: 97 FYAKCG 102 >ref|XP_008466537.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Cucumis melo] Length = 975 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/77 (46%), Positives = 49/77 (63%), Gaps = 5/77 (6%) Frame = -2 Query: 220 VPNQNYT-----YSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYG 56 VPNQ +S L C+Q C+RIQ+ ++ ++ P QA KVIH+K+L +G G Sbjct: 14 VPNQQLVKILSPHSEFLQICLQHCRRIQAHNLFNEKPKAVLQALSTAKVIHSKSLKIGVG 73 Query: 55 LQGKLGNIIVDLYGKCG 5 L+G LGN+IVDLY KCG Sbjct: 74 LKGLLGNVIVDLYVKCG 90 >gb|ADN34182.1| pentatricopeptide repeat-containing protein [Cucumis melo subsp. melo] Length = 1131 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/77 (46%), Positives = 49/77 (63%), Gaps = 5/77 (6%) Frame = -2 Query: 220 VPNQNYT-----YSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYG 56 VPNQ +S L C+Q C+RIQ+ ++ ++ P QA KVIH+K+L +G G Sbjct: 14 VPNQQLVKILSPHSEFLQICLQHCRRIQAHNLFNEKPKAVLQALSTAKVIHSKSLKIGVG 73 Query: 55 LQGKLGNIIVDLYGKCG 5 L+G LGN+IVDLY KCG Sbjct: 74 LKGLLGNVIVDLYVKCG 90 >ref|XP_006299083.1| hypothetical protein CARUB_v10015238mg [Capsella rubella] gi|482567792|gb|EOA31981.1| hypothetical protein CARUB_v10015238mg [Capsella rubella] Length = 1028 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/70 (45%), Positives = 47/70 (67%) Frame = -2 Query: 217 PNQNYTYSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGKLG 38 P+ ++ + LL C+++CK +SR V D+MP + A + K +H+K+L LG+G QG LG Sbjct: 39 PSHDHIHQRLLEICLEQCKLFKSRKVFDEMPQRLALALRTGKAVHSKSLILGFGSQGSLG 98 Query: 37 NIIVDLYGKC 8 N IVDLY KC Sbjct: 99 NAIVDLYAKC 108 >ref|XP_002884708.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330548|gb|EFH60967.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1028 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/74 (43%), Positives = 49/74 (66%) Frame = -2 Query: 223 LVPNQNYTYSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGK 44 ++PN + + LL C+++CK +SR V D+MPH + A + K +H+K+L LG +G+ Sbjct: 37 VLPNHDQIHQGLLEICLEQCKLFKSRKVFDEMPHRLALALRIGKAVHSKSLILGIDSEGR 96 Query: 43 LGNIIVDLYGKCGE 2 LGN IVDLY KC + Sbjct: 97 LGNAIVDLYAKCAQ 110 >ref|XP_006407716.1| hypothetical protein EUTSA_v10019974mg [Eutrema salsugineum] gi|557108862|gb|ESQ49169.1| hypothetical protein EUTSA_v10019974mg [Eutrema salsugineum] Length = 1023 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/72 (45%), Positives = 47/72 (65%) Frame = -2 Query: 217 PNQNYTYSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGKLG 38 P+ + Y LL TC+++CK I+SR V D MP A + K +H+++L LG L+G+LG Sbjct: 34 PSHDQIYDTLLETCLEQCKLIKSRKVFDGMPQRLVHALRTGKAVHSQSLVLGIDLKGRLG 93 Query: 37 NIIVDLYGKCGE 2 N IVDLY KC + Sbjct: 94 NAIVDLYAKCAQ 105 >ref|XP_013623657.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Brassica oleracea var. oleracea] Length = 1023 Score = 70.5 bits (171), Expect = 5e-10 Identities = 30/72 (41%), Positives = 50/72 (69%) Frame = -2 Query: 217 PNQNYTYSNLLYTCVQECKRIQSRHVCDKMPHLKSQATKKCKVIHAKTLSLGYGLQGKLG 38 PN + TY++LL C+++CK +++R V D+MP A++ K +H+++L+LG +G+L Sbjct: 34 PNHDETYNSLLGICLEQCKLLKTRKVFDEMPQRTVHASRIGKAVHSRSLTLGIDSRGRLS 93 Query: 37 NIIVDLYGKCGE 2 N +VDLY KC E Sbjct: 94 NAVVDLYAKCKE 105