BLASTX nr result
ID: Papaver29_contig00061020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00061020 (509 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012477658.1| PREDICTED: mitotic-spindle organizing protei... 63 1e-07 ref|XP_012477653.1| PREDICTED: mitotic-spindle organizing protei... 62 1e-07 ref|XP_012477649.1| PREDICTED: mitotic-spindle organizing protei... 62 2e-07 ref|XP_010258629.1| PREDICTED: mitotic-spindle organizing protei... 61 4e-07 ref|XP_008789684.1| PREDICTED: mitotic-spindle organizing protei... 60 5e-07 emb|CBI32803.3| unnamed protein product [Vitis vinifera] 60 6e-07 ref|XP_006453249.1| hypothetical protein CICLE_v10010500mg, part... 60 6e-07 ref|XP_012440309.1| PREDICTED: mitotic-spindle organizing protei... 60 8e-07 gb|KJB53006.1| hypothetical protein B456_008G288400 [Gossypium r... 60 8e-07 gb|KDO61916.1| hypothetical protein CISIN_1g0405721mg, partial [... 60 8e-07 ref|XP_006474270.1| PREDICTED: mitotic-spindle organizing protei... 60 8e-07 ref|XP_003516891.1| PREDICTED: mitotic-spindle organizing protei... 60 8e-07 ref|XP_003520913.1| PREDICTED: mitotic-spindle organizing protei... 60 8e-07 ref|XP_014491120.1| PREDICTED: uncharacterized protein LOC106753... 59 1e-06 emb|CDP14679.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_002283004.1| PREDICTED: mitotic-spindle organizing protei... 59 1e-06 ref|XP_014507590.1| PREDICTED: mitotic-spindle organizing protei... 59 1e-06 ref|XP_014491121.1| PREDICTED: mitotic-spindle organizing protei... 59 1e-06 ref|XP_008363480.1| PREDICTED: mitotic-spindle organizing protei... 59 1e-06 ref|XP_013462400.1| mitotic-spindle organizing 1B-like protein [... 59 1e-06 >ref|XP_012477658.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X3 [Gossypium raimondii] gi|763741676|gb|KJB09175.1| hypothetical protein B456_001G127500 [Gossypium raimondii] Length = 80 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 125 IIKVYCVNMDPEASRNARESLELAFQMSNILETGLDRHTLS 3 ++K CV MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 1 MVKACCV-MDPEAARTARESLDLAFHMSNILDTGLDRHTLS 40 >ref|XP_012477653.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X2 [Gossypium raimondii] Length = 81 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 125 IIKVYCVNMDPEASRNARESLELAFQMSNILETGLDRHTLS 3 +I C MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 1 MISCACCVMDPEAARTARESLDLAFHMSNILDTGLDRHTLS 41 >ref|XP_012477649.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X1 [Gossypium raimondii] Length = 82 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 110 CVNMDPEASRNARESLELAFQMSNILETGLDRHTLS 3 C MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 7 CCVMDPEAARTARESLDLAFHMSNILDTGLDRHTLS 42 >ref|XP_010258629.1| PREDICTED: mitotic-spindle organizing protein 1A [Nelumbo nucifera] Length = 72 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 MDPEA+R ARESL+LAF MSNILETGLDRHTLS Sbjct: 1 MDPEAARTARESLDLAFHMSNILETGLDRHTLS 33 >ref|XP_008789684.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Phoenix dactylifera] gi|672132212|ref|XP_008789685.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Phoenix dactylifera] Length = 81 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 M+ EA+RNA+ESLELAFQMSNILETGLDRHTLS Sbjct: 1 METEAARNAKESLELAFQMSNILETGLDRHTLS 33 >emb|CBI32803.3| unnamed protein product [Vitis vinifera] Length = 107 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = -1 Query: 146 KFGINASIIKVYCVNMDPEASRNARESLELAFQMSNILETGLDRHTLS 3 KF N + + C MDPEA++ ARESLELAF MSNIL+TGLDRHTLS Sbjct: 22 KFFKNRNPFQSIC--MDPEAAQTARESLELAFHMSNILDTGLDRHTLS 67 >ref|XP_006453249.1| hypothetical protein CICLE_v10010500mg, partial [Citrus clementina] gi|557556475|gb|ESR66489.1| hypothetical protein CICLE_v10010500mg, partial [Citrus clementina] Length = 141 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 104 NMDPEASRNARESLELAFQMSNILETGLDRHTLS 3 +MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 68 DMDPEAARTARESLDLAFHMSNILDTGLDRHTLS 101 >ref|XP_012440309.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Gossypium raimondii] gi|823215106|ref|XP_012440310.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Gossypium raimondii] Length = 73 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLS 33 >gb|KJB53006.1| hypothetical protein B456_008G288400 [Gossypium raimondii] Length = 107 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLS 33 >gb|KDO61916.1| hypothetical protein CISIN_1g0405721mg, partial [Citrus sinensis] Length = 73 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLS 33 >ref|XP_006474270.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X1 [Citrus sinensis] gi|568840635|ref|XP_006474271.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X2 [Citrus sinensis] Length = 73 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLS 33 >ref|XP_003516891.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X1 [Glycine max] gi|571434840|ref|XP_006573311.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X2 [Glycine max] gi|734326949|gb|KHN05647.1| Mitotic-spindle organizing protein 1B [Glycine soja] gi|947127816|gb|KRH75670.1| hypothetical protein GLYMA_01G100100 [Glycine max] gi|947127817|gb|KRH75671.1| hypothetical protein GLYMA_01G100100 [Glycine max] Length = 74 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLS 33 >ref|XP_003520913.1| PREDICTED: mitotic-spindle organizing protein 1B [Glycine max] gi|255633504|gb|ACU17110.1| unknown [Glycine max] gi|947117638|gb|KRH65887.1| hypothetical protein GLYMA_03G068900 [Glycine max] gi|947117639|gb|KRH65888.1| hypothetical protein GLYMA_03G068900 [Glycine max] gi|947117640|gb|KRH65889.1| hypothetical protein GLYMA_03G068900 [Glycine max] Length = 73 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLS 33 >ref|XP_014491120.1| PREDICTED: uncharacterized protein LOC106753781 isoform X1 [Vigna radiata var. radiata] Length = 143 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 104 NMDPEASRNARESLELAFQMSNILETGLDRHTLS 3 +MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 69 SMDPEAARAARESLDLAFHMSNILDTGLDRHTLS 102 >emb|CDP14679.1| unnamed protein product [Coffea canephora] Length = 131 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 MDPEA+R ARESL+L F MSNILETGLDRHTLS Sbjct: 52 MDPEAARTARESLDLVFHMSNILETGLDRHTLS 84 >ref|XP_002283004.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Vitis vinifera] Length = 73 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 MDPEA++ ARESLELAF MSNIL+TGLDRHTLS Sbjct: 1 MDPEAAQTARESLELAFHMSNILDTGLDRHTLS 33 >ref|XP_014507590.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Vigna radiata var. radiata] gi|951003405|ref|XP_014507591.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Vigna radiata var. radiata] Length = 73 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 1 MDPEAARAARESLDLAFHMSNILDTGLDRHTLS 33 >ref|XP_014491121.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X2 [Vigna radiata var. radiata] gi|951071232|ref|XP_014491122.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X2 [Vigna radiata var. radiata] gi|920695522|gb|KOM38747.1| hypothetical protein LR48_Vigan03g212900 [Vigna angularis] Length = 74 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 MDPEASRNARESLELAFQMSNILETGLDRHTLS 3 MDPEA+R ARESL+LAF MSNIL+TGLDRHTLS Sbjct: 1 MDPEAARAARESLDLAFHMSNILDTGLDRHTLS 33 >ref|XP_008363480.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Malus domestica] Length = 91 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 107 VNMDPEASRNARESLELAFQMSNILETGLDRHTLS 3 +NMD +A++ ARESL+LAFQMSNIL+TGLDRHTLS Sbjct: 18 LNMDADAAKTARESLDLAFQMSNILDTGLDRHTLS 52 >ref|XP_013462400.1| mitotic-spindle organizing 1B-like protein [Medicago truncatula] gi|657396419|gb|KEH36435.1| mitotic-spindle organizing 1B-like protein [Medicago truncatula] Length = 107 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 107 VNMDPEASRNARESLELAFQMSNILETGLDRHTLS 3 ++MDPEA+R+ARESL+LAF MSNIL+TGLDRH LS Sbjct: 35 LSMDPEAARSARESLDLAFHMSNILDTGLDRHALS 69