BLASTX nr result
ID: Papaver29_contig00060379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00060379 (614 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012076123.1| PREDICTED: probable calcium-binding protein ... 103 6e-20 ref|XP_011043032.1| PREDICTED: probable calcium-binding protein ... 100 5e-19 ref|XP_002313594.1| hypothetical protein POPTR_0009s16510g [Popu... 100 5e-19 gb|KJB21714.1| hypothetical protein B456_004G009900 [Gossypium r... 100 8e-19 ref|XP_012472852.1| PREDICTED: probable calcium-binding protein ... 100 8e-19 gb|KHG08019.1| putative calcium-binding CML48 -like protein [Gos... 100 8e-19 ref|XP_002523826.1| ef-hand calcium binding protein, putative [R... 100 1e-18 ref|XP_006424234.1| hypothetical protein CICLE_v10029136mg [Citr... 99 1e-18 ref|XP_006424233.1| hypothetical protein CICLE_v10029136mg [Citr... 99 1e-18 ref|XP_006424232.1| hypothetical protein CICLE_v10029136mg [Citr... 99 1e-18 ref|XP_006424231.1| hypothetical protein CICLE_v10029136mg [Citr... 99 1e-18 ref|XP_010271645.1| PREDICTED: probable calcium-binding protein ... 99 2e-18 ref|XP_007015806.1| Calcium-binding EF-hand family protein [Theo... 99 2e-18 gb|KDO58093.1| hypothetical protein CISIN_1g025714mg [Citrus sin... 98 3e-18 gb|KDO58092.1| hypothetical protein CISIN_1g025714mg [Citrus sin... 98 3e-18 gb|KDO58091.1| hypothetical protein CISIN_1g025714mg [Citrus sin... 98 3e-18 ref|XP_006487936.1| PREDICTED: probable calcium-binding protein ... 98 3e-18 ref|XP_006384802.1| hypothetical protein POPTR_0004s21230g [Popu... 97 5e-18 ref|XP_002275521.1| PREDICTED: probable calcium-binding protein ... 97 7e-18 emb|CAN80623.1| hypothetical protein VITISV_043433 [Vitis vinifera] 97 7e-18 >ref|XP_012076123.1| PREDICTED: probable calcium-binding protein CML48 [Jatropha curcas] gi|643725315|gb|KDP34418.1| hypothetical protein JCGZ_12699 [Jatropha curcas] Length = 254 Score = 103 bits (258), Expect = 6e-20 Identities = 59/136 (43%), Positives = 70/136 (51%) Frame = +1 Query: 205 PSAPDLPESYTQQQNPHSYYDXXXXXXXXXXXXXRYNXXXXXXXXXXXXXXXXXXXXXXX 384 PSAP LPESY QQQ Y+ Y Sbjct: 16 PSAPSLPESYEQQQQEGYSYNDPPSSDYRRRQQPPYAVGYGQGQGQGQGQGQGGYSYGTS 75 Query: 385 XXXXXXXXXXXXVSFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVR 564 FP GT+P++IRSF VD+DRSG+IDE ELQ+ALS GYQ+F +RT+R Sbjct: 76 -------------GFPAGTHPDVIRSFQMVDRDRSGYIDENELQQALSSGYQRFHIRTIR 122 Query: 565 LLMFLFKNAYDPLRIG 612 LLMFLF+N YDPLRIG Sbjct: 123 LLMFLFRNPYDPLRIG 138 >ref|XP_011043032.1| PREDICTED: probable calcium-binding protein CML48 [Populus euphratica] Length = 243 Score = 100 bits (250), Expect = 5e-19 Identities = 45/62 (72%), Positives = 55/62 (88%) Frame = +1 Query: 427 FPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPLR 606 FP GT+P++IRSF VD+DRSGFIDE ELQ+A+S GYQ+FS+RT+RLLMFLFKN +DPLR Sbjct: 66 FPPGTSPDVIRSFEMVDRDRSGFIDENELQQAISSGYQRFSIRTIRLLMFLFKNPHDPLR 125 Query: 607 IG 612 G Sbjct: 126 CG 127 >ref|XP_002313594.1| hypothetical protein POPTR_0009s16510g [Populus trichocarpa] gi|222850002|gb|EEE87549.1| hypothetical protein POPTR_0009s16510g [Populus trichocarpa] Length = 247 Score = 100 bits (250), Expect = 5e-19 Identities = 45/62 (72%), Positives = 55/62 (88%) Frame = +1 Query: 427 FPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPLR 606 FP GT+P++IRSF VD+DRSGFIDE ELQ+A+S GYQ+FS+RT+RLLMFLFKN +DPLR Sbjct: 70 FPPGTSPDVIRSFEMVDRDRSGFIDENELQQAVSSGYQRFSIRTIRLLMFLFKNPHDPLR 129 Query: 607 IG 612 G Sbjct: 130 FG 131 >gb|KJB21714.1| hypothetical protein B456_004G009900 [Gossypium raimondii] Length = 193 Score = 100 bits (248), Expect = 8e-19 Identities = 46/62 (74%), Positives = 55/62 (88%) Frame = +1 Query: 427 FPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPLR 606 FP GT+P++IR+F VD+DRSGFIDE ELQ+ALS GYQ+F+LRT+RLLMFLFKN YD LR Sbjct: 64 FPAGTSPDVIRAFQMVDRDRSGFIDEYELQQALSSGYQRFNLRTIRLLMFLFKNPYDSLR 123 Query: 607 IG 612 IG Sbjct: 124 IG 125 >ref|XP_012472852.1| PREDICTED: probable calcium-binding protein CML48 [Gossypium raimondii] gi|763754382|gb|KJB21713.1| hypothetical protein B456_004G009900 [Gossypium raimondii] Length = 235 Score = 100 bits (248), Expect = 8e-19 Identities = 46/62 (74%), Positives = 55/62 (88%) Frame = +1 Query: 427 FPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPLR 606 FP GT+P++IR+F VD+DRSGFIDE ELQ+ALS GYQ+F+LRT+RLLMFLFKN YD LR Sbjct: 64 FPAGTSPDVIRAFQMVDRDRSGFIDEYELQQALSSGYQRFNLRTIRLLMFLFKNPYDSLR 123 Query: 607 IG 612 IG Sbjct: 124 IG 125 >gb|KHG08019.1| putative calcium-binding CML48 -like protein [Gossypium arboreum] Length = 235 Score = 100 bits (248), Expect = 8e-19 Identities = 46/62 (74%), Positives = 55/62 (88%) Frame = +1 Query: 427 FPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPLR 606 FP GT+P++IR+F VD+DRSGFIDE ELQ+ALS GYQ+F+LRT+RLLMFLFKN YD LR Sbjct: 64 FPAGTSPDVIRAFQMVDRDRSGFIDEYELQQALSSGYQRFNLRTIRLLMFLFKNPYDSLR 123 Query: 607 IG 612 IG Sbjct: 124 IG 125 >ref|XP_002523826.1| ef-hand calcium binding protein, putative [Ricinus communis] gi|223536914|gb|EEF38552.1| ef-hand calcium binding protein, putative [Ricinus communis] Length = 246 Score = 99.8 bits (247), Expect = 1e-18 Identities = 45/62 (72%), Positives = 54/62 (87%) Frame = +1 Query: 427 FPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPLR 606 FP GT+P++IRSF VD+DRSGFIDE ELQ+ALS GY +F +RT+RLLMFLFKN +DPLR Sbjct: 69 FPAGTHPDVIRSFQMVDRDRSGFIDENELQQALSSGYHRFHIRTIRLLMFLFKNPHDPLR 128 Query: 607 IG 612 IG Sbjct: 129 IG 130 >ref|XP_006424234.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] gi|557526168|gb|ESR37474.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] Length = 249 Score = 99.4 bits (246), Expect = 1e-18 Identities = 46/63 (73%), Positives = 55/63 (87%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 +FP GT+P++IRSF VD+DRSGFIDE ELQ+ALS GYQ+FSL T+RLLMFLFKN +D L Sbjct: 70 AFPPGTHPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFKNPHDSL 129 Query: 604 RIG 612 RIG Sbjct: 130 RIG 132 >ref|XP_006424233.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] gi|557526167|gb|ESR37473.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] Length = 207 Score = 99.4 bits (246), Expect = 1e-18 Identities = 46/63 (73%), Positives = 55/63 (87%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 +FP GT+P++IRSF VD+DRSGFIDE ELQ+ALS GYQ+FSL T+RLLMFLFKN +D L Sbjct: 70 AFPPGTHPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFKNPHDSL 129 Query: 604 RIG 612 RIG Sbjct: 130 RIG 132 >ref|XP_006424232.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] gi|557526166|gb|ESR37472.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] Length = 163 Score = 99.4 bits (246), Expect = 1e-18 Identities = 46/63 (73%), Positives = 55/63 (87%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 +FP GT+P++IRSF VD+DRSGFIDE ELQ+ALS GYQ+FSL T+RLLMFLFKN +D L Sbjct: 70 AFPPGTHPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFKNPHDSL 129 Query: 604 RIG 612 RIG Sbjct: 130 RIG 132 >ref|XP_006424231.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] gi|557526165|gb|ESR37471.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] Length = 229 Score = 99.4 bits (246), Expect = 1e-18 Identities = 46/63 (73%), Positives = 55/63 (87%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 +FP GT+P++IRSF VD+DRSGFIDE ELQ+ALS GYQ+FSL T+RLLMFLFKN +D L Sbjct: 70 AFPPGTHPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFKNPHDSL 129 Query: 604 RIG 612 RIG Sbjct: 130 RIG 132 >ref|XP_010271645.1| PREDICTED: probable calcium-binding protein CML48 [Nelumbo nucifera] Length = 227 Score = 99.0 bits (245), Expect = 2e-18 Identities = 45/62 (72%), Positives = 54/62 (87%) Frame = +1 Query: 427 FPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPLR 606 FP GT+P+IIRSF +D+DRSGF+D+ ELQE LS+GYQKFSLRT+RLLMFLFKN +P R Sbjct: 52 FPPGTHPDIIRSFQMIDRDRSGFVDKNELQEVLSWGYQKFSLRTIRLLMFLFKNPTEPSR 111 Query: 607 IG 612 IG Sbjct: 112 IG 113 >ref|XP_007015806.1| Calcium-binding EF-hand family protein [Theobroma cacao] gi|508786169|gb|EOY33425.1| Calcium-binding EF-hand family protein [Theobroma cacao] Length = 307 Score = 99.0 bits (245), Expect = 2e-18 Identities = 45/63 (71%), Positives = 55/63 (87%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 SFP GT+PE+IR+F VD+DRSGFIDE ELQ ALS GYQ+F++RT+RLLMFLFKN +D L Sbjct: 61 SFPAGTHPEVIRAFEMVDRDRSGFIDENELQRALSSGYQRFNIRTIRLLMFLFKNPHDSL 120 Query: 604 RIG 612 +IG Sbjct: 121 KIG 123 >gb|KDO58093.1| hypothetical protein CISIN_1g025714mg [Citrus sinensis] Length = 163 Score = 98.2 bits (243), Expect = 3e-18 Identities = 45/63 (71%), Positives = 55/63 (87%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 +FP GT+P++IRSF VD+DRSGFIDE ELQ+ALS GYQ+FSL T+RLLMFLF+N +D L Sbjct: 70 AFPPGTHPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFRNPHDSL 129 Query: 604 RIG 612 RIG Sbjct: 130 RIG 132 >gb|KDO58092.1| hypothetical protein CISIN_1g025714mg [Citrus sinensis] Length = 207 Score = 98.2 bits (243), Expect = 3e-18 Identities = 45/63 (71%), Positives = 55/63 (87%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 +FP GT+P++IRSF VD+DRSGFIDE ELQ+ALS GYQ+FSL T+RLLMFLF+N +D L Sbjct: 70 AFPPGTHPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFRNPHDSL 129 Query: 604 RIG 612 RIG Sbjct: 130 RIG 132 >gb|KDO58091.1| hypothetical protein CISIN_1g025714mg [Citrus sinensis] Length = 249 Score = 98.2 bits (243), Expect = 3e-18 Identities = 45/63 (71%), Positives = 55/63 (87%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 +FP GT+P++IRSF VD+DRSGFIDE ELQ+ALS GYQ+FSL T+RLLMFLF+N +D L Sbjct: 70 AFPPGTHPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFRNPHDSL 129 Query: 604 RIG 612 RIG Sbjct: 130 RIG 132 >ref|XP_006487936.1| PREDICTED: probable calcium-binding protein CML48-like [Citrus sinensis] Length = 249 Score = 98.2 bits (243), Expect = 3e-18 Identities = 45/63 (71%), Positives = 55/63 (87%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 +FP GT+P++IRSF VD+DRSGFIDE ELQ+ALS GYQ+FSL T+RLLMFLF+N +D L Sbjct: 70 AFPPGTHPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFRNPHDSL 129 Query: 604 RIG 612 RIG Sbjct: 130 RIG 132 >ref|XP_006384802.1| hypothetical protein POPTR_0004s21230g [Populus trichocarpa] gi|550341570|gb|ERP62599.1| hypothetical protein POPTR_0004s21230g [Populus trichocarpa] Length = 250 Score = 97.4 bits (241), Expect = 5e-18 Identities = 44/63 (69%), Positives = 55/63 (87%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 +FP GT+P++IRSF VD+DRSGFIDE ELQ+ALS GYQ+F ++TVRLLMFLFKN +D L Sbjct: 72 TFPPGTSPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFHIKTVRLLMFLFKNPHDSL 131 Query: 604 RIG 612 R+G Sbjct: 132 RLG 134 >ref|XP_002275521.1| PREDICTED: probable calcium-binding protein CML48 [Vitis vinifera] Length = 225 Score = 97.1 bits (240), Expect = 7e-18 Identities = 46/63 (73%), Positives = 54/63 (85%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 SFP GT+P++IRSF VD+DRSG+IDE ELQ+ALS GYQ+FSLRT+RLLMFLFKN PL Sbjct: 49 SFPPGTHPDVIRSFQMVDRDRSGYIDEIELQQALSSGYQRFSLRTIRLLMFLFKNPSSPL 108 Query: 604 RIG 612 IG Sbjct: 109 GIG 111 >emb|CAN80623.1| hypothetical protein VITISV_043433 [Vitis vinifera] Length = 225 Score = 97.1 bits (240), Expect = 7e-18 Identities = 46/63 (73%), Positives = 54/63 (85%) Frame = +1 Query: 424 SFPQGTNPEIIRSFHTVDKDRSGFIDERELQEALSFGYQKFSLRTVRLLMFLFKNAYDPL 603 SFP GT+P++IRSF VD+DRSG+IDE ELQ+ALS GYQ+FSLRT+RLLMFLFKN PL Sbjct: 49 SFPPGTHPDVIRSFQMVDRDRSGYIDEIELQQALSSGYQRFSLRTIRLLMFLFKNPSSPL 108 Query: 604 RIG 612 IG Sbjct: 109 GIG 111