BLASTX nr result
ID: Papaver29_contig00060242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00060242 (420 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q06395.1|ML149_PAPSO RecName: Full=Major latex protein 149; S... 57 5e-06 >sp|Q06395.1|ML149_PAPSO RecName: Full=Major latex protein 149; Short=MLP 149 gi|294062|gb|AAA19245.1| major latex protein [Papaver somniferum] Length = 159 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/48 (56%), Positives = 32/48 (66%), Gaps = 6/48 (12%) Frame = -2 Query: 137 IKSMNFIEGHGITSG------YQHEGKEMTVKEKTTYNNEARTISHSV 12 + S +EGHG TSG Y HEGK +T KEKTTYN+E RTI HS+ Sbjct: 45 VTSAKAVEGHGTTSGCVKEWGYMHEGKTLTCKEKTTYNDETRTICHSI 92