BLASTX nr result
ID: Papaver29_contig00054253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00054253 (506 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71214.1| hypothetical protein VITISV_039504 [Vitis vinifera] 58 3e-06 emb|CAN63276.1| hypothetical protein VITISV_000400 [Vitis vinifera] 57 5e-06 emb|CAN79930.1| hypothetical protein VITISV_007488 [Vitis vinifera] 57 7e-06 >emb|CAN71214.1| hypothetical protein VITISV_039504 [Vitis vinifera] Length = 988 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/54 (57%), Positives = 41/54 (75%), Gaps = 5/54 (9%) Frame = -2 Query: 484 RHVDIDKFF-----NNKIVELPKILSKD*LGDIQTIVVPSKVFLKFICKLGMND 338 +HV++D+FF ++KIVELPKILS+D L DI T VV S++F KF+ KLGM D Sbjct: 930 KHVEVDRFFIKEKLDDKIVELPKILSEDQLADILTKVVSSQMFSKFLDKLGMCD 983 >emb|CAN63276.1| hypothetical protein VITISV_000400 [Vitis vinifera] Length = 1030 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = -2 Query: 484 RHVDIDKFF-----NNKIVELPKILSKD*LGDIQTIVVPSKVFLKFICKLGMND 338 +HV++D+FF ++KIVELPKI S+D L DI T VV +VFLKF+ KLGM D Sbjct: 972 KHVEVDRFFIKEKLDDKIVELPKIRSEDQLADILTKVVSCQVFLKFLDKLGMCD 1025 >emb|CAN79930.1| hypothetical protein VITISV_007488 [Vitis vinifera] Length = 1128 Score = 56.6 bits (135), Expect = 7e-06 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = -2 Query: 484 RHVDIDKFF-----NNKIVELPKILSKD*LGDIQTIVVPSKVFLKFICKLGMND 338 +HV++D+FF ++KIVELPKI S+D L DI T VV S+VF KF+ KLGM D Sbjct: 1070 KHVEVDRFFIKEKLDDKIVELPKIRSEDQLADILTKVVSSQVFSKFLDKLGMCD 1123