BLASTX nr result
ID: Papaver29_contig00051566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00051566 (559 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010103712.1| hypothetical protein L484_016624 [Morus nota... 65 2e-08 >ref|XP_010103712.1| hypothetical protein L484_016624 [Morus notabilis] gi|587908924|gb|EXB96854.1| hypothetical protein L484_016624 [Morus notabilis] Length = 408 Score = 65.5 bits (158), Expect = 2e-08 Identities = 35/86 (40%), Positives = 52/86 (60%) Frame = -1 Query: 532 GFMKVETYSNTMFLQSLMWEHLESYAPIPRRILQGPKVDTRLSFLEKNNAKIMRWSRKKP 353 GF+ +ETY +T FLQ+ +WE YAP P + K L FL+ I W R++P Sbjct: 120 GFI-LETYISTAFLQAFLWERFPKYAPKPAEVQDIEKSFGDLRFLDMKIPAICCWFRREP 178 Query: 352 QYKICITNVLDIESEFNFRPWVLVPS 275 + + +VLD+ESEF FRP+V++P+ Sbjct: 179 T-SVDLLSVLDVESEFCFRPFVMLPA 203