BLASTX nr result
ID: Papaver29_contig00050542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00050542 (745 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78945.1| hypothetical protein (mitochondrion) [Vicia faba] 62 5e-07 >gb|AGC78945.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 187 Score = 61.6 bits (148), Expect = 5e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +1 Query: 73 FLKGQLPESNVQLACVKHIASVRSEPGSNSVFYYDCRLKW 192 F QLPE+NV+LACVKHIASV SEPGSNS F YD L+W Sbjct: 148 FPSAQLPENNVRLACVKHIASVPSEPGSNSSFEYDWALQW 187