BLASTX nr result
ID: Papaver29_contig00050509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00050509 (529 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265052.1| PREDICTED: uncharacterized protein LOC100264... 62 1e-07 >ref|XP_002265052.1| PREDICTED: uncharacterized protein LOC100264652 [Vitis vinifera] Length = 123 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 527 IDVHEELSRPIHHKKMVMSLFDSVKLTGVCIYGAEKLES 411 ID+HEELSRPIHH++MVM LF+SV+ G+ + GAEKLES Sbjct: 85 IDIHEELSRPIHHRRMVMPLFESVRRVGISVSGAEKLES 123