BLASTX nr result
ID: Papaver29_contig00049768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00049768 (462 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008808521.1| PREDICTED: twinkle homolog protein, chloropl... 74 4e-11 ref|XP_008808520.1| PREDICTED: twinkle homolog protein, chloropl... 74 4e-11 ref|XP_008807186.1| PREDICTED: twinkle homolog protein, chloropl... 74 6e-11 ref|XP_006656366.1| PREDICTED: twinkle homolog protein, chloropl... 73 1e-10 ref|XP_012700516.1| PREDICTED: twinkle homolog protein, chloropl... 72 1e-10 ref|XP_004966296.2| PREDICTED: twinkle homolog protein, chloropl... 72 1e-10 gb|EMT33643.1| hypothetical protein F775_00849 [Aegilops tauschii] 72 1e-10 ref|XP_002437433.1| hypothetical protein SORBIDRAFT_10g026990 [S... 72 1e-10 dbj|BAD46002.1| unknown protein [Oryza sativa Japonica Group] gi... 72 2e-10 ref|XP_010927027.1| PREDICTED: twinkle homolog protein, chloropl... 72 2e-10 ref|XP_013463045.1| toprim domain protein [Medicago truncatula] ... 72 2e-10 gb|EEC81157.1| hypothetical protein OsI_24073 [Oryza sativa Indi... 72 2e-10 ref|XP_008648959.1| PREDICTED: twinkle homolog protein, chloropl... 72 2e-10 gb|AFW76042.1| hypothetical protein ZEAMMB73_832314 [Zea mays] 72 2e-10 ref|XP_010243933.1| PREDICTED: twinkle homolog protein, chloropl... 71 3e-10 gb|KHN14293.1| DNA primase/helicase [Glycine soja] 71 4e-10 ref|XP_003546288.2| PREDICTED: twinkle homolog protein, chloropl... 71 4e-10 ref|XP_003534794.2| PREDICTED: twinkle homolog protein, chloropl... 71 4e-10 ref|XP_014516908.1| PREDICTED: twinkle homolog protein, chloropl... 70 5e-10 ref|XP_007147436.1| hypothetical protein PHAVU_006G124400g [Phas... 70 5e-10 >ref|XP_008808521.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like isoform X2 [Phoenix dactylifera] Length = 547 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV+WPKKNS DVCKDANEVLM+LGP AL+++IE AE+YP Sbjct: 214 WRVKWPKKNSTDVCKDANEVLMYLGPDALRKVIENAELYP 253 >ref|XP_008808520.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like isoform X1 [Phoenix dactylifera] Length = 699 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV+WPKKNS DVCKDANEVLM+LGP AL+++IE AE+YP Sbjct: 366 WRVKWPKKNSTDVCKDANEVLMYLGPDALRKVIENAELYP 405 >ref|XP_008807186.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Phoenix dactylifera] Length = 698 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV+WPKKNS DVCKDANEVLM+LGP AL++++E AE+YP Sbjct: 367 WRVKWPKKNSTDVCKDANEVLMYLGPDALRKVVENAELYP 406 >ref|XP_006656366.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Oryza brachyantha] Length = 579 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV WPKKN D+CKDANEVLMFLGP ALK++I+ AE+YP Sbjct: 232 WRVNWPKKNETDICKDANEVLMFLGPQALKKVIDNAELYP 271 >ref|XP_012700516.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial isoform X2 [Setaria italica] Length = 750 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV+WPKKN D CKDANEVLMFLGP AL+++IE AE+YP Sbjct: 383 WRVKWPKKNETDTCKDANEVLMFLGPQALRKVIEDAELYP 422 >ref|XP_004966296.2| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial isoform X1 [Setaria italica] gi|944247742|gb|KQL12036.1| hypothetical protein SETIT_005915mg [Setaria italica] Length = 759 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV+WPKKN D CKDANEVLMFLGP AL+++IE AE+YP Sbjct: 383 WRVKWPKKNETDTCKDANEVLMFLGPQALRKVIEDAELYP 422 >gb|EMT33643.1| hypothetical protein F775_00849 [Aegilops tauschii] Length = 634 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV+WPKKN + CKDANEVLMFLGP ALKE+IE AE+YP Sbjct: 308 WRVKWPKKNETEFCKDANEVLMFLGPRALKEVIEGAELYP 347 >ref|XP_002437433.1| hypothetical protein SORBIDRAFT_10g026990 [Sorghum bicolor] gi|241915656|gb|EER88800.1| hypothetical protein SORBIDRAFT_10g026990 [Sorghum bicolor] Length = 770 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV+WPKKN D CKDANEVLMFLGP AL+++IE AE+YP Sbjct: 382 WRVKWPKKNDTDTCKDANEVLMFLGPQALRKVIEDAELYP 421 >dbj|BAD46002.1| unknown protein [Oryza sativa Japonica Group] gi|52077236|dbj|BAD46279.1| unknown protein [Oryza sativa Japonica Group] gi|300116969|dbj|BAJ10651.1| hypothetical protein [Oryza sativa Japonica Group] Length = 695 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV WPKKN ++CKDANEVLMFLGP AL+++IE AE+YP Sbjct: 348 WRVNWPKKNENEICKDANEVLMFLGPQALRKVIEDAELYP 387 >ref|XP_010927027.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Elaeis guineensis] Length = 630 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV+WPKKN DVCKDANEVLM+LGP AL++++E AE+YP Sbjct: 280 WRVKWPKKNDTDVCKDANEVLMYLGPDALRKVVENAELYP 319 >ref|XP_013463045.1| toprim domain protein [Medicago truncatula] gi|657397338|gb|KEH37090.1| toprim domain protein [Medicago truncatula] Length = 687 Score = 72.0 bits (175), Expect = 2e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRVRWPKK D CKDANEVLM+LGP ALKE+IE AE+YP Sbjct: 359 WRVRWPKKGKSDDCKDANEVLMYLGPDALKEVIENAELYP 398 >gb|EEC81157.1| hypothetical protein OsI_24073 [Oryza sativa Indica Group] gi|222636070|gb|EEE66202.1| hypothetical protein OsJ_22328 [Oryza sativa Japonica Group] Length = 698 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV WPKKN ++CKDANEVLMFLGP AL+++IE AE+YP Sbjct: 364 WRVNWPKKNENEICKDANEVLMFLGPQALRKVIEDAELYP 403 >ref|XP_008648959.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Zea mays] Length = 794 Score = 71.6 bits (174), Expect = 2e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV WPKKN D CKDANEVLMFLGP AL+++IE AE+YP Sbjct: 434 WRVNWPKKNDTDTCKDANEVLMFLGPQALRKVIEDAELYP 473 >gb|AFW76042.1| hypothetical protein ZEAMMB73_832314 [Zea mays] Length = 736 Score = 71.6 bits (174), Expect = 2e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRV WPKKN D CKDANEVLMFLGP AL+++IE AE+YP Sbjct: 376 WRVNWPKKNDTDTCKDANEVLMFLGPQALRKVIEDAELYP 415 >ref|XP_010243933.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial [Nelumbo nucifera] Length = 769 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRVRWPKK+ G+VCKDANEVL + GP ALKE+IE AE+YP Sbjct: 438 WRVRWPKKDGGNVCKDANEVLSYYGPDALKEVIENAELYP 477 >gb|KHN14293.1| DNA primase/helicase [Glycine soja] Length = 698 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRVRWP+K+ D CKDANEVLM+LGP ALKE+IE AE+YP Sbjct: 364 WRVRWPRKSRSDNCKDANEVLMYLGPDALKEVIENAELYP 403 >ref|XP_003546288.2| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Glycine max] gi|947062586|gb|KRH11847.1| hypothetical protein GLYMA_15G134500 [Glycine max] Length = 698 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRVRWP+K+ D CKDANEVLM+LGP ALKE+IE AE+YP Sbjct: 364 WRVRWPRKSRSDNCKDANEVLMYLGPDALKEVIENAELYP 403 >ref|XP_003534794.2| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Glycine max] gi|734428234|gb|KHN44661.1| DNA primase/helicase [Glycine soja] gi|947088191|gb|KRH36856.1| hypothetical protein GLYMA_09G028600 [Glycine max] Length = 700 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRVRWP+K+ D CKDANEVLM+LGP ALKE+IE AE+YP Sbjct: 366 WRVRWPRKSRSDNCKDANEVLMYLGPDALKEVIENAELYP 405 >ref|XP_014516908.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial [Vigna radiata var. radiata] Length = 698 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRVRWPKK D CKDANEVLM+LGP ALKE+IE+AE+YP Sbjct: 364 WRVRWPKKGRLDNCKDANEVLMYLGPDALKEVIEKAELYP 403 >ref|XP_007147436.1| hypothetical protein PHAVU_006G124400g [Phaseolus vulgaris] gi|561020659|gb|ESW19430.1| hypothetical protein PHAVU_006G124400g [Phaseolus vulgaris] Length = 697 Score = 70.5 bits (171), Expect = 5e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 462 WRVRWPKKNSGDVCKDANEVLMFLGPHALKEMIEQAEVYP 343 WRVRWPKK D CKDANEVLM+LGP ALKE+I+ AE+YP Sbjct: 364 WRVRWPKKGRSDNCKDANEVLMYLGPDALKEVIDNAELYP 403