BLASTX nr result
ID: Papaver29_contig00049568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00049568 (427 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010254045.1| PREDICTED: NADPH:adrenodoxin oxidoreductase,... 58 3e-06 gb|EMT10176.1| NADPH:adrenodoxin oxidoreductase, mitochondrial [... 56 9e-06 >ref|XP_010254045.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial [Nelumbo nucifera] Length = 487 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 3 SGWEKIDMKEKHEGSQKGKPREKITTWNELLEVAH 107 SGWEKID+KEK EG+ + KPREKI TW ELL+VA+ Sbjct: 452 SGWEKIDIKEKSEGALRNKPREKIATWEELLKVAN 486 >gb|EMT10176.1| NADPH:adrenodoxin oxidoreductase, mitochondrial [Aegilops tauschii] Length = 613 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +3 Query: 6 GWEKIDMKEKHEGSQKGKPREKITTWNELLEVA 104 GWEKID KEK +G K KPREKIT WNELLE A Sbjct: 578 GWEKIDTKEKADGELKNKPREKITRWNELLEAA 610