BLASTX nr result
ID: Papaver29_contig00049390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00049390 (490 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004501059.1| PREDICTED: phosphoglycerate mutase-like prot... 56 9e-06 >ref|XP_004501059.1| PREDICTED: phosphoglycerate mutase-like protein 1 [Cicer arietinum] Length = 349 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 94 DMDSSATATTLFPLHRTKTLHLVRHAQGFHN 2 DMD+S++ TL+PLHR KTLHLVRHAQGFHN Sbjct: 64 DMDTSSSQGTLYPLHRCKTLHLVRHAQGFHN 94