BLASTX nr result
ID: Papaver29_contig00048766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00048766 (1055 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318169.2| hypothetical protein POPTR_0012s10870g [Popu... 65 1e-07 >ref|XP_002318169.2| hypothetical protein POPTR_0012s10870g [Populus trichocarpa] gi|550326836|gb|EEE96389.2| hypothetical protein POPTR_0012s10870g [Populus trichocarpa] Length = 423 Score = 64.7 bits (156), Expect = 1e-07 Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 2/69 (2%) Frame = -1 Query: 1034 MENKVYFPRLH--DERILYYSLETGSYHSVGSTHCAKDYFDTKSWTNCTWIEPNWSRSTS 861 +EN++YFPR + D +Y L G +H+ + H +DY+ T ++++C WIEP++ T Sbjct: 353 LENRIYFPRFNKKDGTCAFYDLSAGKFHTSCNNHGREDYYGTTTFSDCAWIEPSYRMLTD 412 Query: 860 QELVWLNNK 834 QEL WL+ + Sbjct: 413 QELDWLHKE 421