BLASTX nr result
ID: Papaver29_contig00048643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00048643 (470 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH30071.1| hypothetical protein GLYMA_11G156300 [Glycine max... 67 7e-09 gb|KHN21695.1| RING finger protein 44 [Glycine soja] 67 7e-09 ref|XP_006591203.1| PREDICTED: E3 ubiquitin-protein ligase RFWD3... 67 7e-09 ref|XP_002518375.1| ring finger protein, putative [Ricinus commu... 59 3e-08 gb|KHN36398.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja] 64 3e-08 ref|XP_003541074.2| PREDICTED: RING finger protein 38-like [Glyc... 64 3e-08 ref|XP_007146383.1| hypothetical protein PHAVU_006G035700g [Phas... 64 3e-08 ref|XP_007146478.1| hypothetical protein PHAVU_006G043800g [Phas... 62 4e-08 gb|KOM49381.1| hypothetical protein LR48_Vigan08g020800 [Vigna a... 59 9e-08 gb|KRH55090.1| hypothetical protein GLYMA_06G229700 [Glycine max] 63 1e-07 gb|KHN41422.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja] 63 1e-07 gb|KHN16005.1| RING finger protein 44 [Glycine soja] 63 1e-07 ref|XP_006582144.1| PREDICTED: RING finger protein 38-like isofo... 63 1e-07 ref|XP_003527206.2| PREDICTED: uncharacterized protein LOC100820... 63 1e-07 ref|XP_007134874.1| hypothetical protein PHAVU_010G083200g [Phas... 63 1e-07 ref|XP_007134500.1| hypothetical protein PHAVU_010G052600g [Phas... 63 1e-07 gb|KRH55165.1| hypothetical protein GLYMA_06G234500 [Glycine max... 62 1e-07 gb|KHN41425.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja] 62 1e-07 gb|KHN41424.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja] 62 1e-07 ref|XP_003527217.2| PREDICTED: uncharacterized protein LOC100780... 62 1e-07 >gb|KRH30071.1| hypothetical protein GLYMA_11G156300 [Glycine max] gi|947081283|gb|KRH30072.1| hypothetical protein GLYMA_11G156300 [Glycine max] Length = 344 Score = 66.6 bits (161), Expect = 7e-09 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY++QEK+ I +CGHEYHTD +++WL+EKN CP+CK Sbjct: 296 QDEYKNQEKIGILRCGHEYHTDCLKKWLLEKNVCPMCK 333 >gb|KHN21695.1| RING finger protein 44 [Glycine soja] Length = 325 Score = 66.6 bits (161), Expect = 7e-09 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY++QEK+ I +CGHEYHTD +++WL+EKN CP+CK Sbjct: 277 QDEYKNQEKIGILRCGHEYHTDCLKKWLLEKNVCPMCK 314 >ref|XP_006591203.1| PREDICTED: E3 ubiquitin-protein ligase RFWD3-like [Glycine max] gi|947081280|gb|KRH30069.1| hypothetical protein GLYMA_11G156300 [Glycine max] gi|947081281|gb|KRH30070.1| hypothetical protein GLYMA_11G156300 [Glycine max] Length = 309 Score = 66.6 bits (161), Expect = 7e-09 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY++QEK+ I +CGHEYHTD +++WL+EKN CP+CK Sbjct: 261 QDEYKNQEKIGILRCGHEYHTDCLKKWLLEKNVCPMCK 298 >ref|XP_002518375.1| ring finger protein, putative [Ricinus communis] gi|223542470|gb|EEF44011.1| ring finger protein, putative [Ricinus communis] Length = 549 Score = 58.9 bits (141), Expect(2) = 3e-08 Identities = 22/40 (55%), Positives = 30/40 (75%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICKRD 324 +DEY+S+EK+ CGHEYH D +++WL KN CPICK + Sbjct: 501 QDEYKSKEKIGTLDCGHEYHADCLKKWLRVKNVCPICKSE 540 Score = 25.4 bits (54), Expect(2) = 3e-08 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 8/56 (14%) Frame = +3 Query: 63 RTGEKNRLGSLEKTMLDKLKAQTRIECSMPKDVN--------EEIGICSICQAIYQ 206 R G N G E+T+ +LK TR S P +N +E+G C ICQ Y+ Sbjct: 453 RIGSVNT-GLSEETIRSQLK--TRKYLSSPMSINLEEITCMDQELGSCIICQDEYK 505 >gb|KHN36398.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja] Length = 463 Score = 64.3 bits (155), Expect = 3e-08 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICKRD 324 +DEY+SQEK+ I +CGHEYH D +++WL+ KN CPICK + Sbjct: 415 QDEYKSQEKIGILQCGHEYHADCLKKWLLVKNVCPICKSE 454 >ref|XP_003541074.2| PREDICTED: RING finger protein 38-like [Glycine max] gi|947077355|gb|KRH26195.1| hypothetical protein GLYMA_12G158500 [Glycine max] gi|947077356|gb|KRH26196.1| hypothetical protein GLYMA_12G158500 [Glycine max] Length = 458 Score = 64.3 bits (155), Expect = 3e-08 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICKRD 324 +DEY+SQEK+ I +CGHEYH D +++WL+ KN CPICK + Sbjct: 410 QDEYKSQEKIGILQCGHEYHADCLKKWLLVKNVCPICKSE 449 >ref|XP_007146383.1| hypothetical protein PHAVU_006G035700g [Phaseolus vulgaris] gi|561019606|gb|ESW18377.1| hypothetical protein PHAVU_006G035700g [Phaseolus vulgaris] Length = 321 Score = 64.3 bits (155), Expect = 3e-08 Identities = 36/94 (38%), Positives = 51/94 (54%) Frame = +1 Query: 37 NDDAYEELSELEKRIGLGH*KKPC*IS*RRKLVLNVQCLKM*MRKLESALYVRQFIKDEY 216 +D +YE+L L +RIG NV+ R L + RQ DEY Sbjct: 247 DDMSYEDLLILGERIG------------------NVE------RGLSEEIIARQM--DEY 280 Query: 217 ESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +++E++ I +CGHEYH D +R+WL EKN CP+CK Sbjct: 281 KNKEEIGILQCGHEYHADCVRRWLQEKNVCPLCK 314 >ref|XP_007146478.1| hypothetical protein PHAVU_006G043800g [Phaseolus vulgaris] gi|561019701|gb|ESW18472.1| hypothetical protein PHAVU_006G043800g [Phaseolus vulgaris] Length = 160 Score = 62.4 bits (150), Expect(2) = 4e-08 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY+++E++ I +CGHEYH D +R+WL EKN CP+CK Sbjct: 116 QDEYKNKEEIGILQCGHEYHADCVRRWLQEKNVCPLCK 153 Score = 21.6 bits (44), Expect(2) = 4e-08 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = +3 Query: 81 RLGSLEKTMLDKLKAQTRIECS--MPK-----DVNEEIGICSICQAIYQ 206 ++GS+E+ + +++ A+ + + +P EEI +C ICQ Y+ Sbjct: 72 QIGSVERGLSEEIIARQMLTKTYLLPNKEGSASEEEEIDLCIICQDEYK 120 >gb|KOM49381.1| hypothetical protein LR48_Vigan08g020800 [Vigna angularis] Length = 367 Score = 58.9 bits (141), Expect(2) = 9e-08 Identities = 21/38 (55%), Positives = 32/38 (84%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY+++E++ I +CGHEYH D I++WL +KN CP+CK Sbjct: 319 QDEYKNKEEIGILQCGHEYHADCIKRWLHKKNVCPMCK 356 Score = 23.9 bits (50), Expect(2) = 9e-08 Identities = 13/49 (26%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +3 Query: 63 RTGEKNRLGSLEKTMLDKLKAQTRIECSMPKDV-NEEIGICSICQAIYQ 206 R + + G E ++ +++ ++ C +P++ ++EI IC ICQ Y+ Sbjct: 278 RINDNSERGLSEDIIVRQMQTKS---CLLPENFKDQEIDICIICQDEYK 323 >gb|KRH55090.1| hypothetical protein GLYMA_06G229700 [Glycine max] Length = 372 Score = 62.8 bits (151), Expect = 1e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY+++E + I +CGHEYH D +R+WL+EKN CP+CK Sbjct: 324 QDEYKNKENIGILRCGHEYHADCLRRWLLEKNVCPLCK 361 >gb|KHN41422.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja] Length = 458 Score = 62.8 bits (151), Expect = 1e-07 Identities = 22/40 (55%), Positives = 33/40 (82%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICKRD 324 +DEY++QEK+ I +CGHEYH D +++WL+ KN CP+CK + Sbjct: 410 QDEYKNQEKIGILQCGHEYHADCLKKWLLVKNVCPVCKSE 449 >gb|KHN16005.1| RING finger protein 44 [Glycine soja] Length = 343 Score = 62.8 bits (151), Expect = 1e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY+++E + I +CGHEYH D +R+WL+EKN CP+CK Sbjct: 295 QDEYKNKENIGILRCGHEYHADCLRRWLLEKNVCPLCK 332 >ref|XP_006582144.1| PREDICTED: RING finger protein 38-like isoform X1 [Glycine max] gi|571461916|ref|XP_006582145.1| PREDICTED: RING finger protein 38-like isoform X2 [Glycine max] gi|947106778|gb|KRH55161.1| hypothetical protein GLYMA_06G234300 [Glycine max] gi|947106779|gb|KRH55162.1| hypothetical protein GLYMA_06G234300 [Glycine max] Length = 458 Score = 62.8 bits (151), Expect = 1e-07 Identities = 22/40 (55%), Positives = 33/40 (82%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICKRD 324 +DEY++QEK+ I +CGHEYH D +++WL+ KN CP+CK + Sbjct: 410 QDEYKNQEKIGILQCGHEYHADCLKKWLLVKNVCPVCKSE 449 >ref|XP_003527206.2| PREDICTED: uncharacterized protein LOC100820042 [Glycine max] Length = 356 Score = 62.8 bits (151), Expect = 1e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY+++E + I +CGHEYH D +R+WL+EKN CP+CK Sbjct: 308 QDEYKNKENIGILRCGHEYHADCLRRWLLEKNVCPLCK 345 >ref|XP_007134874.1| hypothetical protein PHAVU_010G083200g [Phaseolus vulgaris] gi|561007919|gb|ESW06868.1| hypothetical protein PHAVU_010G083200g [Phaseolus vulgaris] Length = 162 Score = 62.8 bits (151), Expect = 1e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY+++E++ I +CGHEYH D +R+WL EKN CP+CK Sbjct: 118 QDEYKNEEEIGILQCGHEYHADCVRRWLQEKNVCPLCK 155 >ref|XP_007134500.1| hypothetical protein PHAVU_010G052600g [Phaseolus vulgaris] gi|561007545|gb|ESW06494.1| hypothetical protein PHAVU_010G052600g [Phaseolus vulgaris] Length = 148 Score = 62.8 bits (151), Expect = 1e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY+++E++ I +CGHEYH D IR+WL EKN CP+CK Sbjct: 104 QDEYKNKEEIGILQCGHEYHADCIRRWLQEKNVCPLCK 141 >gb|KRH55165.1| hypothetical protein GLYMA_06G234500 [Glycine max] gi|947106783|gb|KRH55166.1| hypothetical protein GLYMA_06G234500 [Glycine max] Length = 311 Score = 62.4 bits (150), Expect = 1e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY+++E + I +CGHEYH D +R+WL+EKN CP+CK Sbjct: 264 QDEYKNKENIGILRCGHEYHADCLRRWLLEKNVCPMCK 301 >gb|KHN41425.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja] Length = 379 Score = 62.4 bits (150), Expect = 1e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY+++E + I +CGHEYH D +R+WL+EKN CP+CK Sbjct: 332 QDEYKNKENIGILRCGHEYHADCLRRWLLEKNVCPMCK 369 >gb|KHN41424.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja] Length = 424 Score = 62.4 bits (150), Expect = 1e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY+++E + I +CGHEYH D +R+WL+EKN CP+CK Sbjct: 377 QDEYKNKENIGILRCGHEYHADCLRRWLLEKNVCPMCK 414 >ref|XP_003527217.2| PREDICTED: uncharacterized protein LOC100780488 [Glycine max] Length = 418 Score = 62.4 bits (150), Expect = 1e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = +1 Query: 205 KDEYESQEKVSIPKCGHEYHTDGIRQWLMEKNFCPICK 318 +DEY+++E + I +CGHEYH D +R+WL+EKN CP+CK Sbjct: 371 QDEYKNKENIGILRCGHEYHADCLRRWLLEKNVCPMCK 408