BLASTX nr result
ID: Papaver29_contig00047971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00047971 (1389 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010058019.1| PREDICTED: uncharacterized protein LOC104445... 62 1e-06 ref|XP_004138931.1| PREDICTED: uncharacterized protein LOC101207... 62 1e-06 ref|XP_012084603.1| PREDICTED: uncharacterized protein LOC105643... 60 5e-06 ref|XP_002530268.1| conserved hypothetical protein [Ricinus comm... 60 5e-06 >ref|XP_010058019.1| PREDICTED: uncharacterized protein LOC104445791 [Eucalyptus grandis] gi|702352369|ref|XP_010058020.1| PREDICTED: uncharacterized protein LOC104445791 [Eucalyptus grandis] gi|629110340|gb|KCW75486.1| hypothetical protein EUGRSUZ_E04248 [Eucalyptus grandis] gi|629110341|gb|KCW75487.1| hypothetical protein EUGRSUZ_E04248 [Eucalyptus grandis] Length = 90 Score = 62.0 bits (149), Expect = 1e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 1387 AEEESLHNIEDLIDTGEYALSLLRKGEIPKYIQ 1289 AEE SLHNIEDL+D GEY+LSLLRKGEIPKYIQ Sbjct: 58 AEERSLHNIEDLMDIGEYSLSLLRKGEIPKYIQ 90 >ref|XP_004138931.1| PREDICTED: uncharacterized protein LOC101207229 [Cucumis sativus] gi|659114654|ref|XP_008457166.1| PREDICTED: uncharacterized protein LOC103496906 [Cucumis melo] gi|700206303|gb|KGN61422.1| hypothetical protein Csa_2G120390 [Cucumis sativus] Length = 90 Score = 62.0 bits (149), Expect = 1e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 1387 AEEESLHNIEDLIDTGEYALSLLRKGEIPKYIQ 1289 +EE SLHNIEDLIDT EY+LSLLRKGEIPKYIQ Sbjct: 58 SEERSLHNIEDLIDTAEYSLSLLRKGEIPKYIQ 90 >ref|XP_012084603.1| PREDICTED: uncharacterized protein LOC105643971 [Jatropha curcas] gi|643715115|gb|KDP27365.1| hypothetical protein JCGZ_20189 [Jatropha curcas] Length = 90 Score = 60.1 bits (144), Expect = 5e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 1387 AEEESLHNIEDLIDTGEYALSLLRKGEIPKYIQ 1289 +EE SLHNI+DLIDT EY+LS+LRKGEIPKYIQ Sbjct: 58 SEERSLHNIDDLIDTAEYSLSILRKGEIPKYIQ 90 >ref|XP_002530268.1| conserved hypothetical protein [Ricinus communis] gi|223530200|gb|EEF32108.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 60.1 bits (144), Expect = 5e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 1387 AEEESLHNIEDLIDTGEYALSLLRKGEIPKYIQ 1289 +EE SLHNI+DLIDT EYALSLLRKGEIPK+IQ Sbjct: 58 SEERSLHNIDDLIDTAEYALSLLRKGEIPKHIQ 90