BLASTX nr result
ID: Papaver29_contig00047652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00047652 (721 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013671749.1| PREDICTED: SNARE-interacting protein KEULE-l... 61 8e-07 emb|CDX98070.1| BnaA06g08210D [Brassica napus] 61 8e-07 emb|CDY30074.1| BnaC05g09460D [Brassica napus] 61 8e-07 ref|XP_009148600.1| PREDICTED: SNARE-interacting protein KEULE-l... 60 1e-06 ref|XP_013638056.1| PREDICTED: SNARE-interacting protein KEULE-l... 60 2e-06 ref|XP_013742626.1| PREDICTED: SNARE-interacting protein KEULE-l... 59 3e-06 ref|XP_010276590.1| PREDICTED: SNARE-interacting protein KEULE [... 59 4e-06 ref|XP_004515765.1| PREDICTED: SNARE-interacting protein KEULE-l... 59 4e-06 emb|CDO97685.1| unnamed protein product [Coffea canephora] 58 5e-06 gb|KDO85822.1| hypothetical protein CISIN_1g043977mg, partial [C... 58 5e-06 ref|XP_010053400.1| PREDICTED: SNARE-interacting protein KEULE [... 58 5e-06 gb|KCW77685.1| hypothetical protein EUGRSUZ_D01986 [Eucalyptus g... 58 5e-06 ref|XP_006445263.1| hypothetical protein CICLE_v10023931mg [Citr... 58 5e-06 emb|CAN60594.1| hypothetical protein VITISV_015220 [Vitis vinifera] 58 5e-06 ref|XP_010108131.1| SNARE-interacting protein KEULE [Morus notab... 58 7e-06 ref|XP_010658345.1| PREDICTED: SNARE-interacting protein KEULE-l... 58 7e-06 ref|XP_010658346.1| PREDICTED: SNARE-interacting protein KEULE-l... 58 7e-06 emb|CBI31407.3| unnamed protein product [Vitis vinifera] 58 7e-06 ref|XP_006363728.1| PREDICTED: SNARE-interacting protein KEULE-l... 58 7e-06 ref|XP_004245704.1| PREDICTED: SNARE-interacting protein KEULE [... 58 7e-06 >ref|XP_013671749.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X1 [Brassica napus] gi|923742668|ref|XP_013671750.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X2 [Brassica napus] Length = 665 Score = 60.8 bits (146), Expect = 8e-07 Identities = 34/76 (44%), Positives = 41/76 (53%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 +PSNSG EP+ KDV L +H P+WLEL HAHIAD A Sbjct: 291 IPSNSGGEPETKDVLLEEHDPIWLELRHAHIAD--------------------------A 324 Query: 67 GERLHEKMTSFV*KIK 20 ERLH+KMT+F+ K K Sbjct: 325 SERLHDKMTNFLSKNK 340 >emb|CDX98070.1| BnaA06g08210D [Brassica napus] Length = 665 Score = 60.8 bits (146), Expect = 8e-07 Identities = 34/76 (44%), Positives = 41/76 (53%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 +PSNSG EP+ KDV L +H P+WLEL HAHIAD A Sbjct: 291 IPSNSGGEPETKDVLLEEHDPIWLELRHAHIAD--------------------------A 324 Query: 67 GERLHEKMTSFV*KIK 20 ERLH+KMT+F+ K K Sbjct: 325 SERLHDKMTNFLSKNK 340 >emb|CDY30074.1| BnaC05g09460D [Brassica napus] Length = 668 Score = 60.8 bits (146), Expect = 8e-07 Identities = 34/76 (44%), Positives = 41/76 (53%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 +PSNSG EP+ KDV L +H P+WLEL HAHIAD A Sbjct: 294 IPSNSGGEPETKDVLLEEHDPIWLELRHAHIAD--------------------------A 327 Query: 67 GERLHEKMTSFV*KIK 20 ERLH+KMT+F+ K K Sbjct: 328 SERLHDKMTNFLSKNK 343 >ref|XP_009148600.1| PREDICTED: SNARE-interacting protein KEULE-like [Brassica rapa] Length = 668 Score = 60.1 bits (144), Expect = 1e-06 Identities = 34/76 (44%), Positives = 40/76 (52%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 +PSNSG EP KDV L +H P+WLEL HAHIAD A Sbjct: 294 IPSNSGGEPQTKDVLLEEHDPIWLELRHAHIAD--------------------------A 327 Query: 67 GERLHEKMTSFV*KIK 20 ERLH+KMT+F+ K K Sbjct: 328 SERLHDKMTNFLSKNK 343 >ref|XP_013638056.1| PREDICTED: SNARE-interacting protein KEULE-like [Brassica oleracea var. oleracea] Length = 668 Score = 59.7 bits (143), Expect = 2e-06 Identities = 33/76 (43%), Positives = 41/76 (53%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 +P+NSG EP+ KDV L +H P+WLEL HAHIAD A Sbjct: 294 IPTNSGGEPETKDVLLEEHDPIWLELRHAHIAD--------------------------A 327 Query: 67 GERLHEKMTSFV*KIK 20 ERLH+KMT+F+ K K Sbjct: 328 SERLHDKMTNFLSKNK 343 >ref|XP_013742626.1| PREDICTED: SNARE-interacting protein KEULE-like [Brassica napus] Length = 668 Score = 58.9 bits (141), Expect = 3e-06 Identities = 33/76 (43%), Positives = 41/76 (53%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 +PSNSG EP+ K+V L +H P+WLEL HAHIAD A Sbjct: 294 IPSNSGGEPETKNVLLEEHDPIWLELRHAHIAD--------------------------A 327 Query: 67 GERLHEKMTSFV*KIK 20 ERLH+KMT+F+ K K Sbjct: 328 SERLHDKMTNFLSKNK 343 >ref|XP_010276590.1| PREDICTED: SNARE-interacting protein KEULE [Nelumbo nucifera] Length = 665 Score = 58.5 bits (140), Expect = 4e-06 Identities = 34/76 (44%), Positives = 39/76 (51%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VPS +G P+ K+V L DH P+WLEL HAHIAD A Sbjct: 293 VPSKTGGPPEKKEVLLEDHDPIWLELRHAHIAD--------------------------A 326 Query: 67 GERLHEKMTSFV*KIK 20 ERLHEKMTSF+ K K Sbjct: 327 SERLHEKMTSFIAKNK 342 >ref|XP_004515765.1| PREDICTED: SNARE-interacting protein KEULE-like [Cicer arietinum] Length = 666 Score = 58.5 bits (140), Expect = 4e-06 Identities = 33/76 (43%), Positives = 39/76 (51%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VP +G +P+ KDV L DH P+WLEL HAHIAD A Sbjct: 294 VPGKNGGQPERKDVLLEDHDPIWLELRHAHIAD--------------------------A 327 Query: 67 GERLHEKMTSFV*KIK 20 ERLHEKMT+F+ K K Sbjct: 328 SERLHEKMTNFISKNK 343 >emb|CDO97685.1| unnamed protein product [Coffea canephora] Length = 685 Score = 58.2 bits (139), Expect = 5e-06 Identities = 34/76 (44%), Positives = 39/76 (51%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VPS SG +P+ K+ L DH P+WLEL HAHIAD A Sbjct: 313 VPSKSGGKPEKKEALLEDHDPIWLELRHAHIAD--------------------------A 346 Query: 67 GERLHEKMTSFV*KIK 20 ERLHEKMT+FV K K Sbjct: 347 SERLHEKMTNFVSKNK 362 >gb|KDO85822.1| hypothetical protein CISIN_1g043977mg, partial [Citrus sinensis] Length = 625 Score = 58.2 bits (139), Expect = 5e-06 Identities = 34/76 (44%), Positives = 40/76 (52%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VPS +G +P+ K+V L DH PVWLEL HAHIAD A Sbjct: 261 VPSKTGGQPEKKEVLLEDHDPVWLELRHAHIAD--------------------------A 294 Query: 67 GERLHEKMTSFV*KIK 20 ERLH+KMT+FV K K Sbjct: 295 SERLHDKMTNFVSKNK 310 >ref|XP_010053400.1| PREDICTED: SNARE-interacting protein KEULE [Eucalyptus grandis] gi|629112726|gb|KCW77686.1| hypothetical protein EUGRSUZ_D01986 [Eucalyptus grandis] Length = 662 Score = 58.2 bits (139), Expect = 5e-06 Identities = 35/76 (46%), Positives = 39/76 (51%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VPS +G P+ K+V L DH PVWLEL HAHIAD A Sbjct: 293 VPSKTGGAPEKKEVILEDHDPVWLELRHAHIAD--------------------------A 326 Query: 67 GERLHEKMTSFV*KIK 20 ERLHEKMT+FV K K Sbjct: 327 SERLHEKMTNFVSKNK 342 >gb|KCW77685.1| hypothetical protein EUGRSUZ_D01986 [Eucalyptus grandis] Length = 661 Score = 58.2 bits (139), Expect = 5e-06 Identities = 35/76 (46%), Positives = 39/76 (51%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VPS +G P+ K+V L DH PVWLEL HAHIAD A Sbjct: 293 VPSKTGGAPEKKEVILEDHDPVWLELRHAHIAD--------------------------A 326 Query: 67 GERLHEKMTSFV*KIK 20 ERLHEKMT+FV K K Sbjct: 327 SERLHEKMTNFVSKNK 342 >ref|XP_006445263.1| hypothetical protein CICLE_v10023931mg [Citrus clementina] gi|568876798|ref|XP_006491457.1| PREDICTED: protein transport Sec1a-like [Citrus sinensis] gi|557547525|gb|ESR58503.1| hypothetical protein CICLE_v10023931mg [Citrus clementina] Length = 664 Score = 58.2 bits (139), Expect = 5e-06 Identities = 34/76 (44%), Positives = 40/76 (52%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VPS +G +P+ K+V L DH PVWLEL HAHIAD A Sbjct: 290 VPSKTGGQPEKKEVLLEDHDPVWLELRHAHIAD--------------------------A 323 Query: 67 GERLHEKMTSFV*KIK 20 ERLH+KMT+FV K K Sbjct: 324 SERLHDKMTNFVSKNK 339 >emb|CAN60594.1| hypothetical protein VITISV_015220 [Vitis vinifera] Length = 263 Score = 58.2 bits (139), Expect = 5e-06 Identities = 38/86 (44%), Positives = 43/86 (50%) Frame = -1 Query: 277 LHILIRICC*VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGL 98 L IL R VPS +G P+ K+V L DH PVWLEL HAHIAD Sbjct: 150 LLILDRSVDQVPSKTGGPPEKKEVLLEDHDPVWLELRHAHIAD----------------- 192 Query: 97 CFDLCTLLYAGERLHEKMTSFV*KIK 20 A ERLHEKMT+F+ K K Sbjct: 193 ---------ASERLHEKMTNFISKNK 209 >ref|XP_010108131.1| SNARE-interacting protein KEULE [Morus notabilis] gi|587930754|gb|EXC17863.1| SNARE-interacting protein KEULE [Morus notabilis] Length = 694 Score = 57.8 bits (138), Expect = 7e-06 Identities = 34/76 (44%), Positives = 39/76 (51%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VPS +G P+ K+V L DH PVWLEL HAHIAD A Sbjct: 323 VPSKTGGPPEKKEVLLEDHDPVWLELRHAHIAD--------------------------A 356 Query: 67 GERLHEKMTSFV*KIK 20 ERLHEKMT+F+ K K Sbjct: 357 SERLHEKMTNFISKNK 372 >ref|XP_010658345.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X1 [Vitis vinifera] Length = 667 Score = 57.8 bits (138), Expect = 7e-06 Identities = 34/76 (44%), Positives = 39/76 (51%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VPS +G P+ K+V L DH PVWLEL HAHIAD A Sbjct: 293 VPSKTGGPPEKKEVLLEDHDPVWLELRHAHIAD--------------------------A 326 Query: 67 GERLHEKMTSFV*KIK 20 ERLHEKMT+F+ K K Sbjct: 327 SERLHEKMTNFISKNK 342 >ref|XP_010658346.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X2 [Vitis vinifera] Length = 665 Score = 57.8 bits (138), Expect = 7e-06 Identities = 34/76 (44%), Positives = 39/76 (51%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VPS +G P+ K+V L DH PVWLEL HAHIAD A Sbjct: 293 VPSKTGGPPEKKEVLLEDHDPVWLELRHAHIAD--------------------------A 326 Query: 67 GERLHEKMTSFV*KIK 20 ERLHEKMT+F+ K K Sbjct: 327 SERLHEKMTNFISKNK 342 >emb|CBI31407.3| unnamed protein product [Vitis vinifera] Length = 736 Score = 57.8 bits (138), Expect = 7e-06 Identities = 34/76 (44%), Positives = 39/76 (51%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VPS +G P+ K+V L DH PVWLEL HAHIAD A Sbjct: 364 VPSKTGGPPEKKEVLLEDHDPVWLELRHAHIAD--------------------------A 397 Query: 67 GERLHEKMTSFV*KIK 20 ERLHEKMT+F+ K K Sbjct: 398 SERLHEKMTNFISKNK 413 >ref|XP_006363728.1| PREDICTED: SNARE-interacting protein KEULE-like [Solanum tuberosum] Length = 666 Score = 57.8 bits (138), Expect = 7e-06 Identities = 34/76 (44%), Positives = 38/76 (50%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VP +G P+ KDV L DH P+WLEL HAHIAD A Sbjct: 293 VPGKAGGPPEKKDVLLEDHDPIWLELRHAHIAD--------------------------A 326 Query: 67 GERLHEKMTSFV*KIK 20 ERLHEKMT+FV K K Sbjct: 327 SERLHEKMTNFVSKNK 342 >ref|XP_004245704.1| PREDICTED: SNARE-interacting protein KEULE [Solanum lycopersicum] Length = 666 Score = 57.8 bits (138), Expect = 7e-06 Identities = 34/76 (44%), Positives = 38/76 (50%) Frame = -1 Query: 247 VPSNSGVEPD*KDVFLGDHSPVWLELCHAHIADVCLISKSLYSCRKSGGLCFDLCTLLYA 68 VP +G P+ KDV L DH P+WLEL HAHIAD A Sbjct: 293 VPGKAGGPPEKKDVLLEDHDPIWLELRHAHIAD--------------------------A 326 Query: 67 GERLHEKMTSFV*KIK 20 ERLHEKMT+FV K K Sbjct: 327 SERLHEKMTNFVSKNK 342