BLASTX nr result
ID: Papaver29_contig00046994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00046994 (609 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509956.1| protein binding protein, putative [Ricinus c... 58 5e-06 >ref|XP_002509956.1| protein binding protein, putative [Ricinus communis] gi|223549855|gb|EEF51343.1| protein binding protein, putative [Ricinus communis] Length = 597 Score = 57.8 bits (138), Expect = 5e-06 Identities = 31/59 (52%), Positives = 38/59 (64%) Frame = -2 Query: 458 METKNDLVWLCLEAATESKESIETWRRQRRTLESMPNXXXXXXXXXXXXXXXLNPSLLE 282 MET++ LV LC+EAA ES+ESI+ WRRQRRTLE +P+ L PSLLE Sbjct: 1 METESQLVRLCIEAACESRESIDKWRRQRRTLERLPSPLADILLRRLLHRRLLFPSLLE 59