BLASTX nr result
ID: Papaver29_contig00046621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00046621 (554 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009368413.1| PREDICTED: methionine aminopeptidase 1A-like... 95 2e-17 ref|XP_008232607.1| PREDICTED: methionine aminopeptidase 1A-like... 95 2e-17 ref|XP_007134837.1| hypothetical protein PHAVU_010G0804000g, par... 95 2e-17 ref|XP_007218112.1| hypothetical protein PRUPE_ppa006771mg [Prun... 95 2e-17 ref|XP_008232609.1| PREDICTED: methionine aminopeptidase 1A [Pru... 94 3e-17 ref|XP_006347886.1| PREDICTED: methionine aminopeptidase 1A-like... 94 3e-17 ref|XP_004229798.1| PREDICTED: methionine aminopeptidase 1A [Sol... 94 3e-17 ref|XP_009382343.1| PREDICTED: methionine aminopeptidase 1A [Mus... 94 4e-17 gb|KDO85762.1| hypothetical protein CISIN_1g0158381mg, partial [... 94 6e-17 ref|XP_006445294.1| hypothetical protein CICLE_v10020473mg [Citr... 94 6e-17 ref|XP_006445293.1| hypothetical protein CICLE_v10020473mg [Citr... 94 6e-17 ref|XP_014515901.1| PREDICTED: methionine aminopeptidase 1A-like... 93 7e-17 gb|KNA03344.1| hypothetical protein SOVF_210100 [Spinacia oleracea] 93 9e-17 ref|XP_008356290.1| PREDICTED: methionine aminopeptidase 1A-like... 93 9e-17 ref|XP_008346292.1| PREDICTED: methionine aminopeptidase 1A-like... 93 9e-17 ref|XP_008346291.1| PREDICTED: methionine aminopeptidase 1A-like... 93 9e-17 ref|XP_008372720.1| PREDICTED: methionine aminopeptidase 1A-like... 93 9e-17 ref|XP_002511681.1| methionine aminopeptidase, putative [Ricinus... 93 9e-17 ref|XP_004514335.1| PREDICTED: methionine aminopeptidase 1A isof... 92 1e-16 ref|XP_004308462.1| PREDICTED: methionine aminopeptidase 1A-like... 92 1e-16 >ref|XP_009368413.1| PREDICTED: methionine aminopeptidase 1A-like [Pyrus x bretschneideri] Length = 396 Score = 94.7 bits (234), Expect = 2e-17 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKVFPWL+A Sbjct: 348 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVFPWLNA 396 >ref|XP_008232607.1| PREDICTED: methionine aminopeptidase 1A-like [Prunus mume] Length = 396 Score = 94.7 bits (234), Expect = 2e-17 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKVFPWL+A Sbjct: 348 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVFPWLNA 396 >ref|XP_007134837.1| hypothetical protein PHAVU_010G0804000g, partial [Phaseolus vulgaris] gi|561007882|gb|ESW06831.1| hypothetical protein PHAVU_010G0804000g, partial [Phaseolus vulgaris] Length = 209 Score = 94.7 bits (234), Expect = 2e-17 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWTDVTADGKRSAQFEHTLLVT++GVEVLTGRL +SP VFPWL++ Sbjct: 161 MWPDGWTDVTADGKRSAQFEHTLLVTDTGVEVLTGRLQTSPSVFPWLNS 209 >ref|XP_007218112.1| hypothetical protein PRUPE_ppa006771mg [Prunus persica] gi|462414574|gb|EMJ19311.1| hypothetical protein PRUPE_ppa006771mg [Prunus persica] Length = 396 Score = 94.7 bits (234), Expect = 2e-17 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKVFPWL+A Sbjct: 348 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVFPWLNA 396 >ref|XP_008232609.1| PREDICTED: methionine aminopeptidase 1A [Prunus mume] Length = 396 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKVFPWL+A Sbjct: 348 MWPDGWTVVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVFPWLNA 396 >ref|XP_006347886.1| PREDICTED: methionine aminopeptidase 1A-like [Solanum tuberosum] Length = 402 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLTGRL +SPKVFPWL + Sbjct: 354 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTGRLPTSPKVFPWLSS 402 >ref|XP_004229798.1| PREDICTED: methionine aminopeptidase 1A [Solanum lycopersicum] Length = 402 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLTGRL +SPKVFPWL + Sbjct: 354 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTGRLPTSPKVFPWLSS 402 >ref|XP_009382343.1| PREDICTED: methionine aminopeptidase 1A [Musa acuminata subsp. malaccensis] Length = 395 Score = 94.0 bits (232), Expect = 4e-17 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLD 410 LWPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKVFPWL+ Sbjct: 347 LWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVFPWLN 394 >gb|KDO85762.1| hypothetical protein CISIN_1g0158381mg, partial [Citrus sinensis] gi|641867079|gb|KDO85763.1| hypothetical protein CISIN_1g0158381mg, partial [Citrus sinensis] Length = 209 Score = 93.6 bits (231), Expect = 6e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKV+PWL+A Sbjct: 161 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVYPWLNA 209 >ref|XP_006445294.1| hypothetical protein CICLE_v10020473mg [Citrus clementina] gi|568875609|ref|XP_006490885.1| PREDICTED: methionine aminopeptidase 1A-like [Citrus sinensis] gi|557547556|gb|ESR58534.1| hypothetical protein CICLE_v10020473mg [Citrus clementina] Length = 399 Score = 93.6 bits (231), Expect = 6e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKV+PWL+A Sbjct: 351 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVYPWLNA 399 >ref|XP_006445293.1| hypothetical protein CICLE_v10020473mg [Citrus clementina] gi|557547555|gb|ESR58533.1| hypothetical protein CICLE_v10020473mg [Citrus clementina] Length = 370 Score = 93.6 bits (231), Expect = 6e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKV+PWL+A Sbjct: 322 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVYPWLNA 370 >ref|XP_014515901.1| PREDICTED: methionine aminopeptidase 1A-like [Vigna radiata var. radiata] Length = 397 Score = 93.2 bits (230), Expect = 7e-17 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWTDVT DGKRSAQFEHTLLVT++GVEVLTGRL +SP VFPWL++ Sbjct: 349 MWPDGWTDVTTDGKRSAQFEHTLLVTDTGVEVLTGRLQTSPNVFPWLNS 397 >gb|KNA03344.1| hypothetical protein SOVF_210100 [Spinacia oleracea] Length = 399 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLTGRL +SP VFPWL A Sbjct: 351 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTGRLPTSPDVFPWLKA 399 >ref|XP_008356290.1| PREDICTED: methionine aminopeptidase 1A-like [Malus domestica] Length = 396 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADG RSAQFEHTLLVTE+GVEVLT RL SSPKVFPWL+A Sbjct: 348 MWPDGWTXVTADGXRSAQFEHTLLVTETGVEVLTARLPSSPKVFPWLNA 396 >ref|XP_008346292.1| PREDICTED: methionine aminopeptidase 1A-like isoform X2 [Malus domestica] Length = 215 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADG RSAQFEHTLLVTE+GVEVLT RL SSPKVFPWL+A Sbjct: 167 MWPDGWTXVTADGXRSAQFEHTLLVTETGVEVLTARLPSSPKVFPWLNA 215 >ref|XP_008346291.1| PREDICTED: methionine aminopeptidase 1A-like isoform X1 [Malus domestica] Length = 232 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADG RSAQFEHTLLVTE+GVEVLT RL SSPKVFPWL+A Sbjct: 184 MWPDGWTXVTADGXRSAQFEHTLLVTETGVEVLTARLPSSPKVFPWLNA 232 >ref|XP_008372720.1| PREDICTED: methionine aminopeptidase 1A-like [Malus domestica] Length = 395 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADG RSAQFEHTLLVTE+GVEVLT RL SSPKVFPWL+A Sbjct: 347 MWPDGWTXVTADGXRSAQFEHTLLVTETGVEVLTARLPSSPKVFPWLNA 395 >ref|XP_002511681.1| methionine aminopeptidase, putative [Ricinus communis] gi|223548861|gb|EEF50350.1| methionine aminopeptidase, putative [Ricinus communis] Length = 397 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSP VFPWL+A Sbjct: 349 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPNVFPWLNA 397 >ref|XP_004514335.1| PREDICTED: methionine aminopeptidase 1A isoform X1 [Cicer arietinum] gi|828334975|ref|XP_012575305.1| PREDICTED: methionine aminopeptidase 1A isoform X2 [Cicer arietinum] Length = 397 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 407 LWPDGWT VTADGKRSAQFEHTLLVTE+GVEVLTGRL +SP V+PWL++ Sbjct: 349 LWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTGRLQTSPNVYPWLNS 397 >ref|XP_004308462.1| PREDICTED: methionine aminopeptidase 1A-like isoform X2 [Fragaria vesca subsp. vesca] Length = 393 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -2 Query: 553 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLD 410 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKV+PWL+ Sbjct: 345 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVYPWLE 392