BLASTX nr result
ID: Papaver29_contig00046323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00046323 (525 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98427.1| unnamed protein product [Coffea canephora] 40 6e-06 >emb|CDO98427.1| unnamed protein product [Coffea canephora] Length = 388 Score = 40.0 bits (92), Expect(2) = 6e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -1 Query: 294 TLDMEKALLRQVVSLSSEQTNILPPEQK 211 T +MEKALL+QV+SL+ EQ N LPPEQ+ Sbjct: 349 TPEMEKALLQQVMSLTPEQINQLPPEQR 376 Score = 36.6 bits (83), Expect(2) = 6e-06 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -2 Query: 509 PGLQDNSAGGLQLPGPPMTGGQI--GNQDPRSPNLT 408 PG++ SA QL G P GQ+ GNQ PR P+LT Sbjct: 314 PGMKQESASAAQLSGQPQFPGQMGTGNQQPRPPSLT 349