BLASTX nr result
ID: Papaver29_contig00045088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00045088 (508 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB18362.1| hypothetical protein B456_003G048700 [Gossypium r... 56 9e-06 >gb|KJB18362.1| hypothetical protein B456_003G048700 [Gossypium raimondii] Length = 86 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 473 LVSQEHSQLLPKSFRLSPGLRAYAALFLPWMSET 372 LVSQ+HSQ P+SFRLSPGLRA A L LPWMSET Sbjct: 7 LVSQKHSQWPPESFRLSPGLRASAVLLLPWMSET 40