BLASTX nr result
ID: Papaver29_contig00044918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00044918 (755 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010909674.1| PREDICTED: E3 ubiquitin-protein ligase ORTHR... 61 9e-07 ref|XP_010909673.1| PREDICTED: E3 ubiquitin-protein ligase ORTHR... 58 8e-06 >ref|XP_010909674.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like isoform X2 [Elaeis guineensis] Length = 714 Score = 60.8 bits (146), Expect = 9e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 227 IFLGGSHKENRSSYAPENGVQCDGAYRIKKCWRK*G 120 ++ G SHKE RSSYAPENGV+ DG YRI+KCWRK G Sbjct: 329 LYTGRSHKEKRSSYAPENGVRYDGIYRIEKCWRKVG 364 >ref|XP_010909673.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like isoform X1 [Elaeis guineensis] Length = 756 Score = 57.8 bits (138), Expect = 8e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 212 SHKENRSSYAPENGVQCDGAYRIKKCWRK*G 120 SHKE RSSYAPENGV+ DG YRI+KCWRK G Sbjct: 376 SHKEKRSSYAPENGVRYDGIYRIEKCWRKVG 406