BLASTX nr result
ID: Papaver29_contig00044891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00044891 (473 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010104914.1| putative beta-1,3-galactosyltransferase 6 [M... 57 5e-06 >ref|XP_010104914.1| putative beta-1,3-galactosyltransferase 6 [Morus notabilis] gi|587914371|gb|EXC02150.1| putative beta-1,3-galactosyltransferase 6 [Morus notabilis] Length = 431 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -2 Query: 124 LSRKWVSFFCISSFILGVLVVNRFWDVPQQVDVVED 17 +S +WVSFFCI SF LGVLVVNRFWDVP V + E+ Sbjct: 13 VSTRWVSFFCILSFFLGVLVVNRFWDVPDTVKMDEE 48