BLASTX nr result
ID: Papaver29_contig00043420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00043420 (531 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096383.1| tRNA wybutosine-synthesizing protein 1-like ... 64 4e-08 gb|KJB14497.1| hypothetical protein B456_002G128000 [Gossypium r... 64 4e-08 gb|KJB14496.1| hypothetical protein B456_002G128000 [Gossypium r... 64 4e-08 ref|XP_012466451.1| PREDICTED: S-adenosyl-L-methionine-dependent... 64 4e-08 ref|XP_010692064.1| PREDICTED: S-adenosyl-L-methionine-dependent... 64 4e-08 ref|XP_009801650.1| PREDICTED: S-adenosyl-L-methionine-dependent... 64 4e-08 emb|CDP07518.1| unnamed protein product [Coffea canephora] 64 4e-08 ref|XP_010061320.1| PREDICTED: S-adenosyl-L-methionine-dependent... 64 4e-08 ref|XP_002301867.2| hypothetical protein POPTR_0002s26220g [Popu... 64 4e-08 ref|XP_007017534.1| Flavodoxin family protein / radical SAM doma... 64 4e-08 ref|XP_007017533.1| Flavodoxin family protein / radical SAM doma... 64 4e-08 ref|XP_007017532.1| Flavodoxin family protein / radical SAM doma... 64 4e-08 gb|AEQ61825.1| flavodoxin family protein [Dimocarpus longan] 64 4e-08 ref|XP_010263670.1| PREDICTED: S-adenosyl-L-methionine-dependent... 64 6e-08 emb|CBI19692.3| unnamed protein product [Vitis vinifera] 64 6e-08 ref|XP_004499150.1| PREDICTED: S-adenosyl-L-methionine-dependent... 64 6e-08 ref|XP_002281468.1| PREDICTED: S-adenosyl-L-methionine-dependent... 64 6e-08 ref|XP_008783493.1| PREDICTED: S-adenosyl-L-methionine-dependent... 63 8e-08 gb|KDO84546.1| hypothetical protein CISIN_1g038595mg, partial [C... 63 8e-08 ref|XP_006473494.1| PREDICTED: tRNA wybutosine-synthesizing prot... 63 8e-08 >ref|XP_010096383.1| tRNA wybutosine-synthesizing protein 1-like protein [Morus notabilis] gi|587874814|gb|EXB63946.1| tRNA wybutosine-synthesizing protein 1-like protein [Morus notabilis] Length = 778 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 332 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEIV 372 >gb|KJB14497.1| hypothetical protein B456_002G128000 [Gossypium raimondii] Length = 610 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 290 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEIV 330 >gb|KJB14496.1| hypothetical protein B456_002G128000 [Gossypium raimondii] Length = 502 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 318 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEIV 358 >ref|XP_012466451.1| PREDICTED: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [Gossypium raimondii] gi|763747056|gb|KJB14495.1| hypothetical protein B456_002G128000 [Gossypium raimondii] Length = 638 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 318 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEIV 358 >ref|XP_010692064.1| PREDICTED: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [Beta vulgaris subsp. vulgaris] gi|870847597|gb|KMS99944.1| hypothetical protein BVRB_1g017890 [Beta vulgaris subsp. vulgaris] Length = 643 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 319 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEIV 359 >ref|XP_009801650.1| PREDICTED: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [Nicotiana sylvestris] Length = 660 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 335 RCMEATPSLACANKCVFCWRHHTNPVGKSWTWKMDDPLEIV 375 >emb|CDP07518.1| unnamed protein product [Coffea canephora] Length = 388 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 327 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEIV 367 >ref|XP_010061320.1| PREDICTED: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [Eucalyptus grandis] gi|629102781|gb|KCW68250.1| hypothetical protein EUGRSUZ_F01897 [Eucalyptus grandis] Length = 649 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 329 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLQIV 369 >ref|XP_002301867.2| hypothetical protein POPTR_0002s26220g [Populus trichocarpa] gi|550345852|gb|EEE81140.2| hypothetical protein POPTR_0002s26220g [Populus trichocarpa] Length = 1307 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 987 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEIV 1027 >ref|XP_007017534.1| Flavodoxin family protein / radical SAM domain-containing protein isoform 3 [Theobroma cacao] gi|508722862|gb|EOY14759.1| Flavodoxin family protein / radical SAM domain-containing protein isoform 3 [Theobroma cacao] Length = 521 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 317 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEIV 357 >ref|XP_007017533.1| Flavodoxin family protein / radical SAM domain-containing protein isoform 2 [Theobroma cacao] gi|508722861|gb|EOY14758.1| Flavodoxin family protein / radical SAM domain-containing protein isoform 2 [Theobroma cacao] Length = 606 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 317 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEIV 357 >ref|XP_007017532.1| Flavodoxin family protein / radical SAM domain-containing protein isoform 1 [Theobroma cacao] gi|508722860|gb|EOY14757.1| Flavodoxin family protein / radical SAM domain-containing protein isoform 1 [Theobroma cacao] Length = 637 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 317 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEIV 357 >gb|AEQ61825.1| flavodoxin family protein [Dimocarpus longan] Length = 640 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 320 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEIV 360 >ref|XP_010263670.1| PREDICTED: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [Nelumbo nucifera] Length = 652 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/41 (65%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+I+ Sbjct: 332 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPLEII 372 >emb|CBI19692.3| unnamed protein product [Vitis vinifera] Length = 499 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 177 RCMEATPSLACANKCVFCWRHHTNPVGKSWRWKMDDPLEIV 217 >ref|XP_004499150.1| PREDICTED: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [Cicer arietinum] Length = 646 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/41 (65%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD ++IV Sbjct: 322 RCMEATPSLACANKCVFCWRHHTNPVAKSWQWKMDDPIEIV 362 >ref|XP_002281468.1| PREDICTED: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [Vitis vinifera] Length = 654 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD L+IV Sbjct: 332 RCMEATPSLACANKCVFCWRHHTNPVGKSWRWKMDDPLEIV 372 >ref|XP_008783493.1| PREDICTED: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase-like isoform X3 [Phoenix dactylifera] Length = 615 Score = 63.2 bits (152), Expect = 8e-08 Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = -1 Query: 276 ESVMLVTVTTGKKLVIAEINSAYTRSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDD 100 E V + T+ +K +++ R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD Sbjct: 268 EMVTPIITTSLEKQILSR-----NRCMEATPSLACANKCVFCWRHHTNPVGKSWRWKMDD 322 Query: 99 ALKIV 85 L IV Sbjct: 323 PLVIV 327 >gb|KDO84546.1| hypothetical protein CISIN_1g038595mg, partial [Citrus sinensis] Length = 534 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/41 (65%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD ++IV Sbjct: 348 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPIEIV 388 >ref|XP_006473494.1| PREDICTED: tRNA wybutosine-synthesizing protein 1 homolog [Citrus sinensis] Length = 649 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/41 (65%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 204 RSMKATPSIGCANN-IFCWRHHTDPVRKSCWWKMDDALKIV 85 R M+ATPS+ CAN +FCWRHHT+PV KS WKMDD ++IV Sbjct: 329 RCMEATPSLACANKCVFCWRHHTNPVGKSWQWKMDDPIEIV 369