BLASTX nr result
ID: Papaver29_contig00041081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00041081 (432 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMZ69461.1| hypothetical protein ZOSMA_213G00020 [Zostera mar... 66 9e-09 ref|XP_010932058.1| PREDICTED: F-box/SPRY domain-containing prot... 60 6e-07 ref|XP_002462273.1| hypothetical protein SORBIDRAFT_02g022900 [S... 60 6e-07 ref|XP_008775591.1| PREDICTED: F-box/SPRY domain-containing prot... 59 1e-06 ref|XP_008775590.1| PREDICTED: uncharacterized protein LOC103695... 59 1e-06 ref|XP_010238088.1| PREDICTED: F-box/SPRY domain-containing prot... 57 4e-06 ref|XP_004956654.1| PREDICTED: F-box/SPRY domain-containing prot... 57 5e-06 >gb|KMZ69461.1| hypothetical protein ZOSMA_213G00020 [Zostera marina] Length = 127 Score = 66.2 bits (160), Expect = 9e-09 Identities = 34/66 (51%), Positives = 46/66 (69%) Frame = -3 Query: 202 EDRQTEKN*RRNQRDRTEQIEMEKKRGVGRDGPSALTLPTHLLTRIFSQLDCVDLLHCAQ 23 E+ +E+N R+ +RD+ E+ E+ GR P AL+LP L+ R+FSQLDCVDLL C+ Sbjct: 18 EESPSEEN-RKIRRDKAEEAGAEENIE-GRTFPMALSLPDDLIGRVFSQLDCVDLLECSV 75 Query: 22 VCKQWY 5 VCKQWY Sbjct: 76 VCKQWY 81 >ref|XP_010932058.1| PREDICTED: F-box/SPRY domain-containing protein 1-like [Elaeis guineensis] Length = 114 Score = 60.1 bits (144), Expect = 6e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 106 PSALTLPTHLLTRIFSQLDCVDLLHCAQVCKQWY 5 P AL P HL++R+FSQLDCVDLL+C+ VCKQWY Sbjct: 34 PPALRAPAHLISRVFSQLDCVDLLNCSLVCKQWY 67 >ref|XP_002462273.1| hypothetical protein SORBIDRAFT_02g022900 [Sorghum bicolor] gi|241925650|gb|EER98794.1| hypothetical protein SORBIDRAFT_02g022900 [Sorghum bicolor] Length = 97 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -3 Query: 136 EKKRGVGRDGPSALTLPTHLLTRIFSQLDCVDLLHCAQVCKQWY 5 E+++ V D +AL P H++ R+FSQLDCVDLL C+ VCKQWY Sbjct: 8 EEEQEVRGDSAAALRAPAHVMARVFSQLDCVDLLSCSLVCKQWY 51 >ref|XP_008775591.1| PREDICTED: F-box/SPRY domain-containing protein 1-like isoform X2 [Phoenix dactylifera] Length = 113 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/55 (50%), Positives = 33/55 (60%), Gaps = 11/55 (20%) Frame = -3 Query: 136 EKKRGVGRDG-----------PSALTLPTHLLTRIFSQLDCVDLLHCAQVCKQWY 5 E GVG +G P L P HL+ R+FSQLDCVDLL+C+ VCKQWY Sbjct: 13 EVAAGVGAEGVRESGKDEGTPPPVLQAPAHLIARVFSQLDCVDLLNCSLVCKQWY 67 >ref|XP_008775590.1| PREDICTED: uncharacterized protein LOC103695921 isoform X1 [Phoenix dactylifera] Length = 163 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/55 (50%), Positives = 33/55 (60%), Gaps = 11/55 (20%) Frame = -3 Query: 136 EKKRGVGRDG-----------PSALTLPTHLLTRIFSQLDCVDLLHCAQVCKQWY 5 E GVG +G P L P HL+ R+FSQLDCVDLL+C+ VCKQWY Sbjct: 13 EVAAGVGAEGVRESGKDEGTPPPVLQAPAHLIARVFSQLDCVDLLNCSLVCKQWY 67 >ref|XP_010238088.1| PREDICTED: F-box/SPRY domain-containing protein 1-like [Brachypodium distachyon] gi|944054310|gb|KQJ89948.1| hypothetical protein BRADI_4g28650 [Brachypodium distachyon] Length = 93 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -3 Query: 106 PSALTLPTHLLTRIFSQLDCVDLLHCAQVCKQWY 5 P+AL P H++ R+FSQLDCVDLL C+ VC+QWY Sbjct: 14 PAALRAPAHVIARVFSQLDCVDLLSCSLVCRQWY 47 >ref|XP_004956654.1| PREDICTED: F-box/SPRY domain-containing protein 1-like [Setaria italica] gi|944259987|gb|KQL24244.1| hypothetical protein SETIT_033466mg [Setaria italica] Length = 97 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -3 Query: 103 SALTLPTHLLTRIFSQLDCVDLLHCAQVCKQWY 5 SAL P H++ R+FSQLDCVDLL C+ VCKQWY Sbjct: 19 SALRAPAHVMARVFSQLDCVDLLSCSLVCKQWY 51