BLASTX nr result
ID: Papaver29_contig00039950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00039950 (613 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525675.1| conserved hypothetical protein [Ricinus comm... 57 6e-06 >ref|XP_002525675.1| conserved hypothetical protein [Ricinus communis] gi|223534975|gb|EEF36658.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 57.4 bits (137), Expect = 6e-06 Identities = 35/84 (41%), Positives = 48/84 (57%) Frame = -3 Query: 443 GFFYALSLVTGTPLSRSLKLDDEAYSSTNQDSVMQQGFMEETGNYEQVILKGEEEGFLIH 264 GF + LS + P +RSLK ++ SS+ QD ++ Q M+ + +GEE F+I Sbjct: 16 GFSFLLSSLA-VPTTRSLKSTEDNPSSSVQDFLIHQEGMDLSS-------QGEELDFIIA 67 Query: 263 GRMVAERADYPGAVANKNHDPKPP 192 GRM E DYPG AN +HDPK P Sbjct: 68 GRMDLESTDYPGTGANNHHDPKTP 91